KEGG   Yersinia kristensenii: CH54_1702Help
Entry
CH54_1702         CDS       T03609                                 

Definition
(GenBank) copper/zinc superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ykr  Yersinia kristensenii
Brite
Enzymes [BR:ykr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH54_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ35434
UniProt: A0A0T9Q4H3
LinkDB All DBs
Position
complement(1828297..1828821)
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAMLFSSSLLAADVTVTLNEALPTGNGKALGTVTVTETPYGLLFTPNLTGLV
AGIHGFHLHENPSCAPGQKDGKAVPALAAGGHFDPQKTGTHLGPYSDKGHLGDLPGLVVN
ADGTATYQVLAPRLKSLSEVKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaatacttactgttaccggcgatgcttttctccagcagtttattggcggca
gatgttaccgtcacattgaatgaagctctgccaactggcaatggaaaggcgctgggtact
gttactgtgaccgaaacgccttatggtttactgtttacgccaaatctgaccgggctggtt
gcgggtattcatggtttccatctccatgagaatccaagttgtgctccggggcagaaagac
ggtaaagctgttcccgcattggctgcgggcggccatttcgatccgcaaaaaaccgggacg
caccttgggccttatagtgataaagggcacttgggtgacttgccggggttggtggtcaat
gccgatggcactgcgacttaccaagtattggctccacgtctgaaatcgttatcagaggtg
aaacagcatgcgctaatgattcatgctggtggtgataactatgccgaccatcccatgcct
ttggggggtggtggtgcgcgaatggcttgtggtgtcatcgagtaa

DBGET integrated database retrieval system