KEGG   Yersinia kristensenii: CH54_1777Help
Entry
CH54_1777         CDS       T03609                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00473  D-Alanine metabolism
ykr00550  Peptidoglycan biosynthesis
ykr01100  Metabolic pathways
ykr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ykr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CH54_1777
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CH54_1777
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CH54_1777
Enzymes [BR:ykr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CH54_1777
Peptidoglycan biosynthesis and degradation proteins [BR:ykr01011]
 Precursor biosynthesis
  Amino acid ligase
   CH54_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATPgrasp_ST RimK ATP-grasp ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AJJ35807
LinkDB All DBs
Position
complement(1922727..1923647)
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGTSAEREVSLLSGQAVLAGLREAGIDAHGVDTRDFPVTQLKEQGFNKVFI
ALHGRGGEDGTLQGVLEFLKLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQ
QFETLSSEELAACVAKLGLPLIVKPSHEGSSVGMSKVDWASELHAALVEAFRHDTDVLIE
KWLSGPEFTVAILGEDVLPSIRIQAPGVFYDYEAKYLSDETQYFCPSGLSVELEQQLAEL
ALQAYQALGCSGWGRVDVMQDSDGGFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILTLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagttgcggtactgctgggtggaacctctgctgaacgtgaagtttcattg
ctatcgggccaggcggttttagccggtttgagagaagccggtatcgacgcccatggggta
gataccagagacttcccggtcactcaattgaaagaacagggttttaataaggtctttatt
gctctgcatggccgtggtggcgaagacggtacattgcaaggtgtgttggagttcctgaaa
ctgccttataccggcagcggcgtgatggcttcggccctgaccatggacaaattgcgcacc
aaattggtgtggcaagccttaggtttgccaatttcgccttatgtggcgctgaaccgtcaa
cagtttgaaacactttcgtcagaggaattagcggcatgtgtcgctaagcttggtctgcct
ttaatcgttaaaccaagtcacgaaggctctagcgtgggcatgagtaaagttgactgggct
agcgaattgcatgctgctctggttgaagctttccgtcatgacaccgatgtgctgattgaa
aaatggttgagcggcccggaattcacggtcgctatccttggcgaggatgttttaccgtcc
atcaggattcaagcacccggtgtgttttatgattatgaagccaagtatctgtctgatgaa
acacagtatttctgcccaagcggtttaagtgttgagttagagcaacaattagcagaatta
gcattacaggcttatcaggcgctaggttgcagcggttggggccgggttgatgtcatgcaa
gacagcgacggcggtttttatctgctggaagtgaatacttcaccggggatgaccagccac
agtttagtgccaatggcagcccgccaatatgggttgagtttttcccagttggtggcccga
attctgacgttggctgactga

DBGET integrated database retrieval system