KEGG   Yersinia kristensenii: CH54_2342Help
Entry
CH54_2342         CDS       T03609                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00564  Glycerophospholipid metabolism
ykr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CH54_2342
Enzymes [BR:ykr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CH54_2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJJ35650
UniProt: A0A0T9PCZ3
LinkDB All DBs
Position
2523864..2525378
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDVDTGQTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKEVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGSLPGGDIGGSRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILAEATSLDSLGEHFGHGLYEAELRYLVEKEWVIELDDAIWRRTKLGMMLDEA
QKQRISEWLAHVQAKKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgct
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgcgct
acgtcttccgccagttccaaactcatccacggtggcctgcgctatctggaacattatgag
ttccgcttggtcagtgaagcattggccgaacgtgaggttttgctgaaaatggctcctcat
attgctttcccgatgcgcttccgcctaccccatcagccccatctgcgcccggcttggatg
attcgcaccggcttattcttgtacgaccacttgggcaaacgcaccagcctgccagccagt
aaagggctgcgttttggaccagaatcagtattgaagcccgaattagtgcgcggtttcgaa
tattcagactgctgggtcgatgatgcccgtctggtggtattgaatgctcaggaagtggtc
gagcgcggcggcgaagtgcgtactcgcaccaaagtgactcgcgcctggcgtgagcaaggt
ttatggatggtggaagctgtggatgtcgacaccggccaaacctttacctggcgtgctaaa
ggtttggtgaatgccaccggcccatgggttaaacagttcttcgatgatggcctgaaactc
aaatcaccttatggtatccgcctaattaaaggcagccatattgtggtgccgcgagttcat
aaccaaccacaagcctatattctacaaaacgaagaccatcgtattgtcttcgtcatccca
tggttggatgaatattccatcatcggcaccaccgacgtggaatatcacggcgatcctaaa
gaggtgaaaatagatgaccaggaaattgattatctgttgaaggtctataacgaccacttt
aaaaagcagctgggtcgcgacgatatcgtctggacttactctggtgtccgtccgctatgt
gatgatgaatcagattcgccgcaagcggttacccgcgattacacactggatgtcgcggat
gaaggcggcaaagcgccgctgctgtcggtatttggcggcaaactgaccacttaccgcaaa
ctggcagaacacgcgctggaaaaactgtccggctattatccgaatgttggcccggcgtgg
acaaaaaccggctctttaccgggcggagatattggcggcagccgtgataactatactgtg
cagttgcgccatcgctataactggctaccagaagggttagcgcgccgctatacccgtacc
tatggcagccacagcgaactaattttggcggaagccaccagcctcgacagcttgggcgaa
cattttggccatggtttgtatgaagcagaattgcgctatctggttgaaaaagagtgggtt
attgaactcgatgatgccatctggcggcgcaccaagttaggtatgatgctagatgaagcg
caaaaacagcggatttccgaatggctagcgcacgttcaggcgaagaaacaacagacattg
tccttagtttcctga

DBGET integrated database retrieval system