KEGG   Yersinia kristensenii: CH54_2462Help
Entry
CH54_2462         CDS       T03609                                 

Definition
(GenBank) iron/manganese superoxide dismutase, alpha-hairpin domain protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ykr  Yersinia kristensenii
Brite
Enzymes [BR:ykr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH54_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AJJ34011
UniProt: A0A0T9PH36
LinkDB All DBs
Position
2674629..2675252
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSFFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttacgatgctttagaaccccatttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaataatgcaaac
acggtgttggagagcttccctgagctggctaaattcagcgttgaagacctgatcaaagat
ctggacaaagtcccggcagaaaaacgcacctttatgcgtaataacgccggcggccacgct
aaccatagctttttctggaaaggcctgaaactgggcaccactctgaccggtgacctgaaa
gccgctatcgagcgcgacttcggcagcgttgacagcttcaaagaaaaatttgagcaagct
gcggcaacgcgtttcggttcaggttgggcttggctggttctgaaagatgatggcaaactg
gcggttgtttctactgctaaccaagacagtccgctgatgggcgaagctgtttctggcgca
tctggcttcccgattattggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagcattctggaacgtcgttaactgggacgaagccgcc
gcgcgtttcgctcaagctaagtaa

DBGET integrated database retrieval system