KEGG   Yersinia kristensenii: CH54_2656Help
Entry
CH54_2656         CDS       T03609                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00260  Glycine, serine and threonine metabolism
ykr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CH54_2656 (tdh)
Enzymes [BR:ykr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CH54_2656 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C HI0933_like FAD_binding_2 Pyr_redox_3 FAD_oxidored UDPG_MGDP_dh_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJJ34157
UniProt: A0A0T9PXA0
LinkDB All DBs
Position
2873237..2874292
Genome map
AA seq 351 aa AA seqDB search
MKALSTETLSMKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIYNWDEW
SQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNT
VGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLVGEDVLVS
GAGPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMAELGMT
EGFDVGLEMSGAPPAFRTLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGLFIKGIYGRE
MFETWYKMAALIQSGLDLTPIITHRFSIDEFQQGFDAMRSGKSGKVILNWD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgtctacggaaacattgtctatgaaagcactatccaaactaaaagcagaa
gaaggtatttggatgaccgatgtgccgcagccggagctgggccacaatgacatcatgatc
aaaattcgtaaaacggctatttgtggcactgatgtgcatatctataactgggatgaatgg
tcacaaaaaactattcctgtccctatggtggttggtcacgaatatgtcggtgaagtggtg
gctatcggtcaggaagttaaaggctttaatattggtgaccgggtgtctggcgaggggcat
attacctgtggacattgtcgcaattgccggggtgggcgcacccacctttgccgcaatacc
gtgggtgtcggcgtaaaccgccctggttcttttgccgaatatctggtgattccggccttt
aatgctttcaaaattcccgacaatatttctgatgaactcgcggctatttttgatccgttc
ggtaatgctgtgcataccgcgttatcctttgatttagttggggaagatgtgctggtttcc
ggcgctggcccgattggtatcatggccgctgcggtctgtaagcatgtcggcgctcgccat
gttgttatcactgatgtgaatgaataccgcctggatctggcgcgaaaaatgggggtaacc
cgcgcagttaatgtcagcaaagagaacctgaatgatgtgatggctgaactgggcatgact
gaagggtttgatgtcggtctggaaatgtccggtgcgccgcctgccttccgcacattgctt
aactcaatgaatcacggtggccgtattgcgatgctggggataccgccatcggatatgtct
atcgactggaatcaggtgattttcaaggggctgtttatcaaagggatttatggccgtgag
atgttcgaaacctggtacaaaatggcagctctgattcaatccggtttagacttaaccccg
attatcacccaccgtttctccattgatgagttccagcaaggttttgatgctatgcgctcg
gggaaatcaggtaaggtaatattaaactgggattga

DBGET integrated database retrieval system