KEGG   Yersinia kristensenii: CH54_2944Help
Entry
CH54_2944         CDS       T03609                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH54_2944
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ykr02000]
    CH54_2944
Enzymes [BR:ykr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH54_2944
Transporters [BR:ykr02000]
 Other Transporters
  Pores ion channels [TC:1]
   CH54_2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJJ34906
UniProt: A0A0T9Q123
LinkDB All DBs
Position
3198620..3199291
Genome map
AA seq 223 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPSSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKSYLNKQIATHRDYLEQHLAKNQWFAGSDFSAADIQMSFPI
EAINTRNGLEGLPKLQNFLVRIHQRPAYQQAIEKGGAFKLENG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcacaacgaatcttgtggatgctggaa
gagttacaagttccctacgagttgaagcgctatcagcgcgaccccagcagcttgttggca
ccaccggagttgaaaaaaatccacccgttggggaaatcgccagtgattactgatggcgac
ctgacactggcggaatcaggagccattatcgagtatctacaggaaacctatgatgcacag
ggcttgtttaagcccactggccattatgatcgccaacaattccgttattggatgcattat
gctgaagggtcattgatgccgttgctggtgatgaagcttattttcagccgcttcggtggg
ccgccagtgccgtggattattcgcccggtagccaaggcattgggtgatggggtacaaaaa
agttatttgaataagcaaatagccactcatcgcgattatctggaacaacatttagcaaag
aatcaatggtttgccggcagtgatttcagtgccgcagatattcaaatgagttttcctatc
gaggcaatcaacacccgtaatgggcttgagggcttgccaaaactgcaaaatttcttggtg
cgtatccatcagcgcccggcttatcagcaggcgattgaaaagggcggcgctttcaaatta
gaaaatggataa

DBGET integrated database retrieval system