KEGG   Yersinia kristensenii: CH54_3092Help
Entry
CH54_3092         CDS       T03609                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00250  Alanine, aspartate and glutamate metabolism
ykr00410  beta-Alanine metabolism
ykr00430  Taurine and hypotaurine metabolism
ykr00650  Butanoate metabolism
ykr01100  Metabolic pathways
ykr01110  Biosynthesis of secondary metabolites
ykr01120  Microbial metabolism in diverse environments
ykr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ykr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CH54_3092
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH54_3092
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH54_3092
   00430 Taurine and hypotaurine metabolism
    CH54_3092
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CH54_3092
Enzymes [BR:ykr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH54_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJJ35129
UniProt: A0A0T9PMU3
LinkDB All DBs
Position
3354835..3356235
Genome map
AA seq 466 aa AA seqDB search
MTKKSLDDYRSTLLDSRFGSQAIRHISENKNFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGEQGVG
TNTIGSSEACMLGGMAMKWRWRKKREAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIREI
PMVPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYEFPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPDEGIPAICFRIKEGAKTGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLLDDFKSSLKYLSEHPSLGGLASQNSFNHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaatctctggatgattatcgctctacgttattagattcccgctttggctct
caagccattcgtcatatttcagaaaataaaaattttcctaaagaggagatgcgcgaggat
attgcttttcaaatcataagtgacgagctatttcttgatggtaatgcgcgacagaatctc
gcgacattttgccaaacgtgggacgacgataatgtccacaagttaatggacctttcgata
aataaaaactggattgataaagaggaatatccgcaatcggcggcaatagatatgcgttgt
gtaaacatgatggccgatttgtggaatgcacctacgccaaaaggtgagcaaggggtgggg
acgaataccattggttcttcagaagcttgcatgctgggtggcatggcgatgaagtggcgc
tggcgcaaaaaaagagaagcggcaggtaaacccacgaataagcctaattttgtctgtggg
ccggtacaagtttgttggcataaatttgctcgttattgggatgtcgaaatacgtgaaatt
cctatggttccagggcaattatttatggacccacagcggatgatagaggcatgcgacgaa
aatactattggcgtagtgccgactttcggtgtgacttacacaggtaactatgagtttcct
aaacccttgcatgatgcgctggataagctacaaaaagatactggccttgatattgatatg
catatcgatgcggcgagtggtggctttttagcgccctttgttgcgccggatattgagtgg
gatttccgtttgccacgggtgaaatcaatcagcacttccgggcataaattcggattggca
cctttgggatgtggttgggttatttggcgtgatgcggcagccttacctgaagagcttata
tttaatgtcgattatcttggcggtcaggtcggcacttttgctatcaatttctcgcgcccc
gcagggcaagttatttcccaatattatgaattcatacgcttagggcgtgaaggttatacc
aaggtacaaagtgcctgttatcaggtggcagaattcctagctaaagaaattgcaccactt
gggccttatgagttctattgcagtggtggcccggatgagggtattcccgccatctgtttc
cgtattaaagagggggcaaaaacgggatataccttatatgacctttccgagcgtttgagg
ctacgtggttggcaagttccggcatttaccttgagtggaaagatgtctgatgttgtggtc
atgcgtattatgtgccgccgcggattcgaaatggatttcgccgggctgttattagacgat
tttaaatcttcactgaaatacctaagtgaacatccatcccttgggggcctggcaagtcag
aatagttttaatcatacataa

DBGET integrated database retrieval system