KEGG   Yersinia kristensenii: CH54_3094Help
Entry
CH54_3094         CDS       T03609                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00220  Arginine biosynthesis
ykr00250  Alanine, aspartate and glutamate metabolism
ykr00471  D-Glutamine and D-glutamate metabolism
ykr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ykr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH54_3094 (glsA)
   00220 Arginine biosynthesis
    CH54_3094 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CH54_3094 (glsA)
Enzymes [BR:ykr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CH54_3094 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AJJ37326
UniProt: A0A0T9PMN2
LinkDB All DBs
Position
3357955..3358899
Genome map
AA seq 314 aa AA seqDB search
MTINLARLNQVINDVHSQYSMLAGGENASYIPYLASVPSQLAGLAIVTVGGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSAIKASSREERWARILDIQQQLAGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLFSTIELATMGATFAAGGRNPVTQKQVLTASNMPYILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKGPLL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactattaacctagctcgcctgaatcaagttattaacgatgtccattcgcaatattcc
atgctcgctggtggggagaatgccagctatattccctatctggccagtgttcccagtcag
ctggccgggctagctattgtcactgttggtggcgatattatttcacaaggcgatgctgat
tttcgttttgctttagagtcgatttcgaaagtgtgttctcttgctttggcattagaagat
attggcccacaagcagtgcaggacaagataggcgcagatcctaccggtttgccttttaac
tcggtgattgcgttggaactgcataatggcaaaccattgtcaccgctggtaaatgcgggg
gcgatgtccacagtgagtgcaattaaggccagcagtcgggaagagcgctgggcgcgtatt
ttggatattcagcagcaactggcgggtgcgccgattgcactttcggatgaagttaaccat
tcagaacaaaccaccaattttcacaatcgggccattgcctggctactttattcggcccag
gccatgtattgcgacccgatggaagcctgtgacgtctatacccgccagtgttcaacattg
ttcagtaccattgaactggcaaccatgggggccactttcgcggcaggcggcagaaatcct
gtgactcaaaaacaggtgctgacggcctcaaatatgccatatattttggctgaaatgacc
atggaagggatgtatggtagctccggtgattgggcttataccgtggggttaccgggtaaa
agtggtgtcggcggcggaattttggcggtcgtgccgggcgtcatggggattgctgcattt
tcgccgccccttgaccccgtaggtaatagcgtacgcggccaaaaaatggtggcgtcagtg
gctcagcagttgggatataacttatataaaggcccgcttttgtaa

DBGET integrated database retrieval system