KEGG   Yersinia kristensenii: CH54_324
Entry
CH54_324          CDS       T03609                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00480  Glutathione metabolism
ykr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH54_324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ykr02000]
    CH54_324
Enzymes [BR:ykr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH54_324
Transporters [BR:ykr02000]
 Other transporters
  Pores ion channels [TC:1]
   CH54_324
SSDB
Motif
Pfam: GST_C GST_N GST_N_2 GST_C_3 GST_N_3 GST_C_2 GST_N_5
Other DBs
NCBI-ProteinID: AJJ34846
LinkDB
Position
complement(337402..338004)
AA seq 200 aa
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLRINPKGQVPALLLDDG
SLLTEGVAIVQYLADIVPDRQLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDSELAKHDYLLGSKFSVADAYLFTVTRWANALKLDIKQRSHLDK
YMARVAGRPAVKEALAAEKI
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgttctttgtccccccatattgtattacgtgaa
gcggggctagatttcagtattgaaagcgtcgatctggcgactaaaaaaactgaaacgggt
gaagactatttgcgcatcaatccaaaaggacaagttcctgctctgttactggatgacgga
agcctactcaccgaaggtgtggctatcgtgcaatatctggcagacatcgtgcccgatcgt
cagctaattgcaccatcaggcaccctttctcgctatcacgccattgagtggttaaatttc
gtggcgactgaattacataaaggcttcagcccactgtttaacccgaaaacacccgatgaa
tataaagcgattgctcgtgagcggctggataaacaattcagctacgtcgatagcgaatta
gcaaaacatgattatctgttaggctcaaaattcagtgtagccgacgcctatctatttacg
gtcacccgttgggcgaatgcactgaagcttgatattaagcagcgcagccatttagacaaa
tatatggcgcgggtagctggccgcccggcagtaaaagaagccttggcagcagaaaagata
taa

DBGET integrated database retrieval system