KEGG   Yersinia kristensenii: CH54_3859Help
Entry
CH54_3859         CDS       T03609                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00071  Fatty acid degradation
ykr00280  Valine, leucine and isoleucine degradation
ykr00281  Geraniol degradation
ykr00310  Lysine degradation
ykr00362  Benzoate degradation
ykr00380  Tryptophan metabolism
ykr00410  beta-Alanine metabolism
ykr00640  Propanoate metabolism
ykr00650  Butanoate metabolism
ykr00903  Limonene and pinene degradation
ykr00930  Caprolactam degradation
ykr01100  Metabolic pathways
ykr01110  Biosynthesis of secondary metabolites
ykr01120  Microbial metabolism in diverse environments
ykr01130  Biosynthesis of antibiotics
ykr01200  Carbon metabolism
ykr01212  Fatty acid metabolism
Module
ykr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CH54_3859 (fadJ)
   00650 Butanoate metabolism
    CH54_3859 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH54_3859 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH54_3859 (fadJ)
   00310 Lysine degradation
    CH54_3859 (fadJ)
   00380 Tryptophan metabolism
    CH54_3859 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH54_3859 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH54_3859 (fadJ)
   00281 Geraniol degradation
    CH54_3859 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH54_3859 (fadJ)
   00930 Caprolactam degradation
    CH54_3859 (fadJ)
Enzymes [BR:ykr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CH54_3859 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CH54_3859 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CH54_3859 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJJ35746
LinkDB All DBs
Position
4168916..4171153
Genome map
AA seq 745 aa AA seqDB search
MSQENILNRGDEIAIVGSAVPAHSVFTLDVRPDNIGIITIDVVGDKVNTLKAEFAEQIAE
ILQQAQALSQLQGLVIISGKPDSFIAGADISMIAACRTAQDARVLAQKGQSILAQIAAFP
VPVVAAIHGACLGGGLELALACHSRICSQDDKTVLGLPEVQLGLLPGSGGTQRLPRLVGV
SKALDMILTGRQVRGRQALKMGLVDDVVPHDILLDVAIQRAKAGWLDKPILPWQERLLSG
PLGKSLLFNIVRKKTRAKTKGHYPAAERIIDVVRKGLDHGGPAGYEAEAKAFGELAMSPE
SAALRSLFFATTALKKETGGKEQPRAIHRVGVLGGGLMGGGIANVTATRAGLPVRIKDIN
PTGINQALKYTWDTLGERVRSKRMRPAERQRQMMLISGSTDYCGFGNVDIVVEAVFEDLS
LKQQMVADIEHFAAPHTIFASNTSSLPISDIAAQAQRPEQVIGLHYFSPVDKMPLVEVIP
HAKTSEATIATTVALARKQGKTAIVVADCAGFYVNRILAPYINEAARCILDGEPIDLIDK
ALVDFGFPVGPITLLDEVGIDVGTKIMPILVEKLGARFAAPPSFDVILKDGRKGRKNGRG
FYLYPAKSSGFKWKKSSGKQVDTSVYTLLGVTPKAHLESAVIAQRCVMMMLNEAARCLDE
SIIRNPRDGDIGAVFGIGFPPFLGGPFRYMDNLGAETMVKTLSLLAQQYGERFEPCSLLV
TMAEQQQRFYPPENSMNERAVNPDN
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggaaaatattcttaatcgcggggatgaaatagccatagttggctctgccgtt
ccggcccattcggttttcaccctcgatgttcggcccgataatattggtatcatcaccatt
gatgttgtcggtgataaagttaataccttaaaggctgaatttgcagagcaaattgctgaa
atactgcaacaagcgcaggctttgagtcaattacagggtttagttattatttctggcaaa
ccggactcttttatcgccggtgcagatatcagcatgattgctgcttgtcgcaccgcacaa
gatgcgcgtgttctggcccagaaagggcaatccattctggcacaaattgcggcatttcca
gtgccggtagtcgctgctatccacggggcttgcctcggcggtggtctggaactggcgctg
gcgtgtcatagccgcatttgctcgcaggatgataaaactgtgctcggtttgcctgaggta
cagcttgggctgttgccggggtccggtggcacccagcgtttgccgcgtctggtgggggtg
agtaaggcactggatatgatattgactggccggcaggttcgcggccgtcaggcacttaaa
atggggctggtggacgacgtggtgccgcacgatattttgcttgatgtggctatccagcgg
gctaaagccggttggcttgataagcccatcttgccgtggcaggagcgtttgcttagcggc
ccattaggtaaatcattgttatttaatattgttcgtaagaaaacacgggcaaagacaaaa
ggtcattatccagcagccgagcgtattattgatgtggtgcgtaaggggttagaccacggc
ggccctgcgggttatgaagccgaagcaaaagcctttggtgagctggcaatgtctcctgag
tcagcagcattacgcagcttgttttttgcgaccaccgcgctgaaaaaagagactggtggc
aaagaacagcctcgggctatccatcgagtcggggtattaggtggggggctgatgggcgga
ggtatagccaatgtgactgcaacacgtgcgggtttaccggttcggattaaagatatcaat
ccaacaggcattaaccaggcgctgaaatatacctgggataccttgggcgagcgggtgcgt
agcaagcggatgcgcccggcagagcggcaacgccagatgatgctgatttccggcagcact
gattattgtggctttggtaatgtggatattgtggttgaggcggtatttgaagatttgtcg
ttgaagcagcagatggtggcagatattgagcatttcgctgcacctcataccattttcgct
tccaacacttcgtcactgccgataagtgatatcgcggcacaggcacagcggccagagcag
gttatcggtctgcattactttagcccggtggataaaatgccattggtggaagttattccg
catgcaaagactagcgaagcaaccattgcaaccactgttgctttagcacgtaaacaggga
aaaacagcgattgtggtggcagattgtgccgggttctatgtaaaccgtattttggctcca
tacattaatgaagcagctcgctgtatattagatggtgaacctatcgatttaattgataag
gctctggtcgatttcggctttccggtaggcccgataaccttgttggatgaagttgggatt
gatgtgggcaccaagataatgcccattctggtagagaaattaggggcacgttttgctgcg
ccgccttcatttgatgtcattttgaaagatgggcggaaagggcgtaaaaatggccgcggt
ttctatctttatccagctaaaagtagcggtttcaagtggaagaaaagttccggtaagcaa
gtggacaccagcgtttataccttactcggtgtcacaccgaaggcccatctagaatctgcc
gtgatagcacagcgttgcgtcatgatgatgctgaatgaagccgcacgttgtctggatgaa
tctattatccgtaacccgcgcgatggggatattggtgcggtgtttgggattggtttccca
ccgtttttaggcgggcctttccgctatatggataacctgggcgcagaaacaatggtaaaa
acactgagtttgctcgcgcaacagtatggtgagcgctttgaaccttgctcattattggtc
acgatggctgagcagcaacaaaggttttatccgccggaaaatagtatgaatgagcgggca
gtcaatcccgataattaa

DBGET integrated database retrieval system