KEGG   Yersinia kristensenii: CH54_3977Help
Entry
CH54_3977         CDS       T03609                                 

Definition
(GenBank) beta-lactamase family protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ykr  Yersinia kristensenii
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ykr01002]
    CH54_3977
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ykr01011]
    CH54_3977
Enzymes [BR:ykr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CH54_3977
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CH54_3977
Peptidases and inhibitors [BR:ykr01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CH54_3977
Peptidoglycan biosynthesis and degradation proteins [BR:ykr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CH54_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AJJ36636
UniProt: A0A0T9N7A8
LinkDB All DBs
Position
complement(4317249..4318391)
Genome map
AA seq 380 aa AA seqDB search
MDKRLLKHFSSPLLAAALFTIPLHGYANTELLTSQVVDQYAEHIFYNSGAMGMALVVIDN
NQVVNRSFGETKPGNNLRPRPDSLIRIASITKLMTSEVMVKLAEDGTVKLTDPLQKWAPK
GAKVPAYNAKQPMTLLNLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLKLANMTVPP
GVKAAYSNLAYDLLADALSRASGKPYTSLLRDKITAPLGMRNTTLTPTAEQCSRLMIGVG
SSRCENTIAAAGSGGVYSTPEDMQRWMQQFLASNNNARKSTAKREQALYFQRRDLVSLKG
MDVAGQADALGLGWVYMAPNAELPGIMQKTGGGGGFITYMAMIPEKNIAVFVVVTRTQLT
KFTNMSDGVNRLVAQLAKNS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaagattgctgaaacatttttcttccccgttactggccgcggctctgttcact
atcccactgcacggctacgccaacaccgagcttttgacatcacaagttgttgatcaatat
gccgaacatatcttctataacagcggggccatggggatggcgctggtcgttattgataat
aatcaagtagttaaccgcagttttggcgaaaccaagcccggtaacaatttgcgcccacgg
ccagattcattgatccgcattgcctctattaccaagctgatgaccagtgaggtgatggta
aaactggctgaggatggcacagtaaaattaactgaccctttgcaaaaatgggcccctaaa
ggagccaaagtcccagcttataatgcgaaacagccgatgactttgctcaatctggccagc
cacaccagcggcctgcctcgtgaacagcccggtggcccgcaaaaaaggccggtgtttacc
tggccgaccaaagataaccgctggcaatggttgaaactggccaatatgactgtgccccct
ggtgtgaaagcggcttattccaatttggcttacgatttgctggcagacgcgctatcacgc
gcctccgggaaaccttataccagcttattacgagataaaatcaccgcaccgctgggtatg
cgaaacaccaccctcaccccaacggcagagcaatgtagccgtttgatgatcggcgtgggc
agcagccgctgtgaaaacaccatagcggcggcgggcagtggcggggtttactcgacacca
gaagatatgcagcgctggatgcagcaattcttagcttccaataacaacgcacgtaaaagc
acagccaaacgtgaacaagcgctgtatttccaacgtcgcgatttggtttcattaaaaggg
atggatgttgccggtcaggccgatgcgctggggctaggctgggtctacatggcaccaaat
gctgaactgccgggcatcatgcagaaaaccggtggcggtggcggatttattacttatatg
gcgatgatccccgagaagaatattgcggttttcgtggtggtcacccgcacgcaactgacg
aaattcaccaatatgagtgatggcgtgaatcggttggtcgcgcagttagcgaagaatagc
tga

DBGET integrated database retrieval system