KEGG   Yersinia kristensenii: CH54_3993Help
Entry
CH54_3993         CDS       T03609                                 

Definition
(GenBank) pseudouridine synthase family protein
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
ykr  Yersinia kristensenii
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ykr03009]
    CH54_3993
Enzymes [BR:ykr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     CH54_3993
Ribosome biogenesis [BR:ykr03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    CH54_3993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AJJ36248
LinkDB All DBs
Position
4336479..4337186
Genome map
AA seq 235 aa AA seqDB search
MRLDKFLSQQLGVSRALVARELRAKRVTVDGEIVKSGAIKLTPEQDVRFDGNPLQQTVGP
RYFMLNKPQGYVCSTEDPDHPTVLYFLDEPVAYKLHAAGRLDIDTTGLVLMTDDGQWSHR
ITSPRHHCEKTYLVTLEHPVADDTAQQFTDGVQLHNEKSLTKPAQLEVIEPQLVRLTISE
GRYHQVKRMFGAVGNRVLELHRERIGDIKLDDDLAPGEYRPLTAEEIASVGAPHL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgattggacaagtttttatctcagcaattaggggttagccgggcgttggtcgcgcgc
gagctacgggcaaaacgcgtcactgttgatggcgaaatagtcaaaagtggtgccattaag
ctgacgccagaacaagacgtgagatttgatggcaacccattacaacagacagttggccca
cgttattttatgctgaacaaaccgcagggttatgtgtgttcaacagaagacccggatcac
ccaaccgtgctgtatttccttgatgaacccgtggcttataagcttcacgcggcagggcgg
ttagacatcgacaccaccgggctggtgctgatgaccgacgatggtcaatggtcgcaccgc
attacctctccacgccatcattgcgaaaaaacctatttggtgacactggaacacccggtt
gctgatgatacggcgcagcagtttactgacggcgtacagttgcataacgaaaaatcattg
acgaaaccggcgcagcttgaagttatcgagcctcagctagtgcgtttgactatcagtgaa
gggcgctaccatcaggtaaaacgcatgtttggtgcggtcggaaatcgtgtgctggaactg
catcgtgaacgtattggcgacatcaaacttgatgatgatttagcacccggtgagtatcgc
ccactgactgccgaagaaattgcgagtgtcggcgctcctcatctgtaa

DBGET integrated database retrieval system