KEGG   Yersinia kristensenii: CH54_525Help
Entry
CH54_525          CDS       T03609                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ykr01100  Metabolic pathways
ykr01110  Biosynthesis of secondary metabolites
ykr01130  Biosynthesis of antibiotics
ykr01230  Biosynthesis of amino acids
ykr02024  Quorum sensing
Module
ykr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH54_525 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CH54_525 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH54_525 (trpE)
Enzymes [BR:ykr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CH54_525 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AJJ36731
LinkDB All DBs
Position
569358..570920
Genome map
AA seq 520 aa AA seqDB search
MQTSRPTLQLLTTTGCYRDDPTALFHQLCGARPATLLLESAEVTSKQNLKSLLIVDSALR
ITALGQKVTIEALTRNGASLLPLLDSALPAQVEIQVRPNGRELTFPVINDVQDEDSRLQA
LSVFDALRLLLKLVEAPAAEREAMFMGGLFAYDLVAGFENLPQLRHESRCPDFCFYLAET
LLVLDHQHRSTRLQASLFTPDNSEHQRLTARLEQLAHQLQQAPQPIPAKSVPEMTLQCNQ
SDEEYGAVVSELQQAIRQGEIFQVVPSRRFSLPCPSPLAAYQTLKDSNPSPYMFFMQDNE
FSLFGASPESALKYDATNRQIEIYPIAGTRPRGRRANGELDRDLDSRIELEMRTDHKELA
EHLMLVDLARNDLARICEPGSRYVADLTKVDRYSFVMHLVSRVVGTLRHDLDVLHAYQAC
MNMGTLSGAPKVRAMQLIAGSERSRRGSYGGAVGYLTAHGDLDTCIVIRSAYVEDGVATV
QAGAGVVLDSVPQAEADETRNKARAVLRAIATAHHAREVF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctcgcgtcctactttacagttattgaccactacggggtgttaccgtgatgac
ccaaccgcactgtttcaccagctctgcggcgcacggccagcaacattgctgcttgaatct
gcggaagtgaccagcaaacaaaacctgaaaagcttgctgatagtcgacagtgcgctgcgt
atcaccgcactgggacagaaagtgacgatagaagcgctgacacgcaatggcgcttcttta
ttaccactgttggactcagcattacccgcgcaagttgagattcaagtgcgcccaaatggc
cgcgaactgacgtttcccgtcattaatgacgtgcaagatgaagactctcgcttacaggca
ttatccgtttttgatgctttgcgcctgctgctgaaactggtcgaggctccagcggcagag
cgggaagccatgtttatgggaggtttgtttgcctacgatttggtcgccggttttgaaaac
ttgccgcagttgcgccatgaaagccgctgcccggatttctgtttctatttagccgaaaca
ttattggtgctggatcaccaacaccgctccacacgtttgcaagccagtttgttcactccg
gataacagcgagcatcagcgcttaacggcccgtttagaacagcttgcccaccaattgcaa
caagcgccacagcctattccagccaaatcagtgccggaaatgacgttacagtgtaaccaa
tcagatgaagagtacggcgcagtggtcagtgaattacagcaagccattcgccaaggtgag
attttccaagtggtaccttcccgccgcttctcattaccgtgcccatcaccactggcggcg
taccaaacactgaaagacagtaatccaagcccttatatgttcttcatgcaggataatgaa
ttttctttgttcggtgcctcaccagagagcgcactgaaatacgacgccaccaatcgccag
attgaaatttatccgattgccggtactcgtcctcgtggccgtcgcgctaatggtgaactg
gaccgcgatttagacagccgcattgagctggaaatgcgcaccgaccataaagaactggcc
gagcatttgatgttggtggatttagcccgtaatgacctggcgcgcatctgtgagccgggc
agccgttacgtggcagatttaaccaaagttgaccgctattcctttgttatgcatctggtt
tctcgcgtagtgggcactttgcgccacgatttagatgtgctgcatgcgtatcaagcttgt
atgaacatggggacattaagtggcgcacccaaagtccgggcaatgcaattaatcgctggc
agtgagaggtcacgtcggggcagctacggcggtgccgtcggctatctcaccgcccatggc
gatctggatacctgcattgtgattcgctctgcttatgttgaagacggggttgctactgta
caagcaggtgctggcgtggtgctggattcagtcccacaggcggaagccgatgaaacccgc
aataaagctcgcgcggttttgcgcgcaattgccacggcacatcacgccagggaggtgttc
taa

DBGET integrated database retrieval system