KEGG   Yersinia kristensenii: CH54_554Help
Entry
CH54_554          CDS       T03609                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ykr  Yersinia kristensenii
Pathway
ykr00240  Pyrimidine metabolism
ykr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ykr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CH54_554
Enzymes [BR:ykr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CH54_554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AJJ37094
UniProt: A0A0T9P2J0
LinkDB All DBs
Position
complement(602058..602657)
Genome map
AA seq 199 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAL
LYNSGTSLLSIINTEHQGSPVHCILLDECQFLTKEQVQELCQVVDELHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDAQGRAVHDGEQVVIGGNESYVS
VCRRHYKEAIKAASLSQYP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactcagcaatgaatgcaggtaaatctacagcgctattg
cagtcctcttataactaccaagagcgtggtatgcgcactctggtgtttacagccgagatt
gataatcgctttggggttggaacagtcagttcgcgtattggtctgtcttcacaggccctg
ctttacaatagtgggacatcattattatctataatcaacaccgagcatcagggaagtccg
gtccattgtattttactcgatgagtgccaatttttgactaaagagcaggttcaggaattg
tgccaggtggtggatgaattgcatatccctgtgctgtgttatggtttacgcactgacttc
ctcggtgagttattccctggcagtaaatacttattgtcgtgggctgacaaattggtcgag
ctaaagacaatttgtcattgtgggcgtaaggctaatatggtgttacgtttagatgcacag
ggccgggctgttcacgatggtgaacaagttgttatcggtgggaatgaaagctacgtttct
gtttgccgacgccattataaagaagccatcaaagctgcctccctctctcaatatccttaa

DBGET integrated database retrieval system