KEGG   Yarrowia lipolytica: YALI0B14355gHelp
Entry
YALI0B14355g      CDS       T01033                                 

Definition
(RefSeq) YALI0B14355p
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:yli01009]
    YALI0B14355g
Protein phosphatases and associated proteins [BR:yli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YALI0B14355g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6 LRR_1
Motif
Other DBs
NCBI-GeneID: 2906652
NCBI-ProteinID: XP_500880
UniProt: Q6CEN2
LinkDB All DBs
Position
B:complement(1911597..1912655)
Genome map
AA seq 352 aa AA seqDB search
MTAEDTKPEAKAQPTQEPAAETESAVTVVPPSFESDVSEDEEEEAFEAIEADEDLLADAD
LDILDIDLTHLKIRDFAKLGLGRFKQLETLCLRQNISPSTDGLEEVSDTLVDLDVYDNRI
GKIENVNHLVNLTNLDFSFNKIRHIKNVSKLTKVINFYLCQNKIQEIRGLDNMPDLVNLE
LGANRIRVIENLDHLKNLRQLWLGKNKIRKLSGLSGLESLETLSIQSNRITKIEGLEKLK
NLEELYISHNGITKIEGLEHNTKLRTLDITGNPITTLEGVSHLKDLEEFWASDCKLSNYK
EIETELGQLPNLETVYFERNPLHRENPATYRNKVRLCLGPSLRQIDATFIKS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaggacaccaaacctgaagccaaggctcagcccacccaagagcctgctgct
gagacagaatcggctgtcacagtggttcctccatctttcgagtccgacgtttccgaagat
gaagaggaggaagctttcgaggcaattgaggccgacgaagaccttctggccgatgctgac
ctcgacattctcgacattgacctcactcatctcaagatccgtgactttgccaagcttggt
ctgggtcgattcaagcagcttgagaccctctgtctgcgacagaacatttctcctagcacg
gatggcctggaggaggtatctgataccctggttgatctcgacgtgtacgataaccgaatt
ggcaagatcgagaatgtgaaccatctggtgaacctcaccaatctggatttctccttcaac
aagatccgtcacatcaagaacgtcagcaaactcacaaaggtcatcaacttctatctttgc
cagaacaagatccaggaaattcgaggtctggacaacatgcctgatcttgttaaccttgag
cttggagccaaccgaatccgagtcattgagaacttggaccatctcaagaacctgcgtcag
ctgtggctcggaaagaacaagatccgaaagctgtctggtctgtcgggactggagagtcta
gaaaccctgtctattcaatccaacagaatcaccaaaatcgagggtctggagaaactgaag
aacctggaagagctgtacattagtcacaacggaatcacgaagatcgagggcctggaacac
aacaccaagctgcgaaccctggacattactggaaaccccatcaccaccctggagggtgtt
tcgcacctcaaggatctggaggagttctgggcctcggattgcaagctctccaactacaag
gagattgagactgagcttggacagctgccaaacctcgaaacagtctactttgagcgaaac
cctctgcaccgagaaaaccctgccacctacagaaacaaggtgcgactttgtttgggccct
tcccttcgacagattgacgctactttcatcaagtcttag

DBGET integrated database retrieval system