KEGG   Yarrowia lipolytica: YALI0C19624gHelp
Entry
YALI0C19624g      CDS       T01033                                 

Definition
(RefSeq) YALI0C19624p
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
yli  Yarrowia lipolytica
Pathway
yli00061  Fatty acid biosynthesis
yli00062  Fatty acid elongation
yli01100  Metabolic pathways
yli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YALI0C19624g
   00062 Fatty acid elongation
    YALI0C19624g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     YALI0C19624g
    1.3.1.-  
     YALI0C19624g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N DUF2183
Motif
Other DBs
NCBI-GeneID: 2909944
NCBI-ProteinID: XP_502018
UniProt: Q6CBE4
LinkDB All DBs
Position
C:complement(2662343..2663473)
Genome map
AA seq 376 aa AA seqDB search
MLRTLRTSQLARSGFGTPSFGLRFNSVGRAFVFSQTGEPKDVIQVLEYPIEKPLENQVLL
KSLGFTINPADINQLEGVYPSVPPKSVQINNEDAAIGGNEGLFQVLDPGAKSGLKKGDWV
LPRKTCFGTWRSHALVEADTVVKIDNTDLTKVQATTVSVNPSTAYEMLKDLKEGDWFIQN
GGNSGVGRAAIQIGHIRGLKSISVVRDRPDLEVLKKELTDLGATHVITEEEASDKLFSKQ
IKSWTGGKIKLALNCIGGKSATSIMRQLGAGGSIVTYGGMSKKPLTFPTGPFIFKDITAK
GYWLTRWADKHPEEKAKTIENIFKFYREKKFVAPPVNISTLDFSKGNDVVLSEFLDALGK
AQKGGGKKQLVQWVEY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctacgaacacttcgaacctctcaattggcacgatccggctttggaacgccctctttt
ggtctgcgatttaactccgttggccgggcgtttgtcttctcccaaactggcgagcccaag
gacgtgatccaggtgctggagtatcccattgagaagcctctggagaaccaggtgctgctt
aagtcgctcggattcactatcaacccggctgacattaaccaattggagggcgtttatccc
tctgtgcctcccaaatccgtccagatcaacaacgaagacgctgctattggaggcaacgag
ggtctgttccaggtgcttgatcccggtgccaagtctggactgaagaagggcgactgggtt
cttcctcgaaagacatgctttggaacctggcgatcacatgctctggtggaggctgacacc
gttgtgaagattgacaacactgatctcaccaaggtgcaggctaccactgtgtctgttaac
ccctctactgcttacgagatgctcaaggacctcaaggagggcgactggttcattcagaac
ggtggtaacagcggtgttgggcgagcagctattcagattggccacatccgaggtctcaag
agcatctctgtggtcagagatcgtcctgatctcgaagtgctcaagaaggaactcaccgat
ctgggcgccacccacgtaatcactgaggaggaggcctcggataagttgttttccaagcag
atcaagtcctggaccggcggaaagattaagctggctctcaactgtattggaggaaagagc
gccacttccatcatgcgacagctgggagccggaggatccattgtcacttacggaggcatg
tctaagaagcctcttacgttccccactggcccttttatcttcaaggacatcactgccaag
ggctactggctgactcgatgggccgataagcaccctgaagagaaggctaagaccattgag
aacatcttcaagttctaccgagaaaagaagtttgtggctcctcccgttaacatttcgact
ctggacttcagcaagggtaacgacgttgttctgtccgagtttttggacgcccttggaaag
gctcagaagggcggaggtaagaagcagctggttcagtgggtggagtactag

DBGET integrated database retrieval system