KEGG   Yarrowia lipolytica: YALI0C21021gHelp
Entry
YALI0C21021g      CDS       T01033                                 

Definition
(RefSeq) YALI0C21021p
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yli  Yarrowia lipolytica
Pathway
yli00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YALI0C21021g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yli02000]
    YALI0C21021g
Enzymes [BR:yli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YALI0C21021g
Transporters [BR:yli02000]
 Other Transporters
  Pores ion channels [TC:1]
   YALI0C21021g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 2909874
NCBI-ProteinID: XP_502071
UniProt: Q6CB91
LinkDB All DBs
Position
C:2815693..2816364
Genome map
AA seq 223 aa AA seqDB search
MAITLYTFSTPNGVKISIALELLKLQYKAVNVDITKGEQKTPEFLKVSLNGRIPAITDTE
GPGSTSSAPFSLFESGAILQYLADKYDPEYKISYKPGTLEHYKTNEWLFFQNAGLGPMQG
QANHFVKFAPEKVPYGIKRYTDETKRLYGVLEERLKENGTGFLVGDHISIADISTVGWVQ
CSHFIDIDLTEFPEVNKWLDRLLAIEGVKKGFDVPVKWPFFKE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggccatcactctctacactttctccaccccgaacggagtcaaaatctccattgctctc
gagctgcttaagctgcagtacaaggccgtcaacgtcgacatcaccaagggcgaacagaag
actcccgagttcctcaaggtgtctctgaacggacgaatacccgccatcaccgacaccgaa
ggtcccggttctacctcctcggcccccttttctctgtttgagtctggagctattctgcag
tatctggctgacaagtacgatccagaatacaagatctcgtacaagcccggaactctggag
cattacaaaaccaacgagtggctgtttttccagaatgccggtctcggacccatgcaggga
caggccaaccattttgtcaagttcgcccccgagaaggtgccctacggcatcaagagatac
accgacgagaccaagcgactgtacggcgtgctggaggagcggctgaaggagaacggaacc
ggcttcctggttggagaccacatttccattgcagatatctccactgtcggctgggtccaa
tgctcccactttatcgatatcgatcttaccgagttccccgaggtcaacaagtggctggac
cgactcctcgccattgagggcgtcaagaagggcttcgatgtgcccgtgaagtggcctttc
ttcaaggagtaa

DBGET integrated database retrieval system