KEGG   Yarrowia lipolytica: YALI0D11374gHelp
Entry
YALI0D11374g      CDS       T01033                                 

Definition
(RefSeq) YALI0D11374p
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00020  Citrate cycle (TCA cycle)
yli00190  Oxidative phosphorylation
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yli_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0D11374g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YALI0D11374g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YALI0D11374g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 2910350
NCBI-ProteinID: XP_502696
UniProt: Q6C9G6
LinkDB All DBs
Position
D:complement(1423590..1425506)
Genome map
AA seq 638 aa AA seqDB search
MLRAIKNPRAVLKSRHFSTSPVVAKVFANGPVKAQEAPSHVASKYAVVDHEYDCVVVGAG
GAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHPDNWKWHMYDTVKGS
DWLGDQDAIHYMTKEAPKSIIELEHYGVPFSRNDEGRIYQRAFGGQSKDYGKGGQAYRTC
AVADRTGHAMLHSLYGQSLRHNTHFFIEYFAMDLLMEDGACVGVVAYNQEDGTLHRFRAH
KTVLATGGYGRAYFSCTSAHTCTGDGMAMVTRAGLPLQDLEFVQFHPTGIYGSGCLITEG
SRGEGGYLLNKNGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGQHGDHIFLQLSH
LPASVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVLTQDENGQD
KVVEGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVAHRITETLTPGAPLPPVSADIG
YESIANLDKMRNADGPLSTATIRDKMQRTMQMDVSVFRTQESLEDGVRGITAVDRLIDQV
GVTDRSMIWNTDLTETLELQNLLTCAMQTAYSAVARKESRGAHAREDYPDRDDVNWMKHT
LSWQDKPGDEIKLGYRAVQMHTLDESECPTVPPAKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagctatcaaaaacccccgagccgttctcaagtctcgtcacttctccacctcc
ccggtggtggccaaggtcttcgccaacggccccgtcaaggcccaggaggccccctcccac
gtggcgtccaagtacgccgtcgtcgaccacgagtacgattgtgttgttgttggagccggt
ggagccggtctccgagccgccttcggtctggccgaggctggcttcaacaccgcttgtatc
tccaagctgttccccacccgatcccacaccgtcgctgcgcagggaggtatcaacgccgct
ctcggaaacatgcaccccgataactggaagtggcacatgtatgacaccgtcaagggttcc
gattggctcggagaccaggacgccatccactacatgaccaaggaggcccccaagtccatt
atcgagctggaacactacggtgttcccttctctcgaaacgacgagggccgaatctaccag
cgagccttcggtggtcagtccaaggactacggtaagggaggccaggcctaccgaacctgt
gccgttgccgaccgaaccggccacgccatgctgcactctctttacggacagtctctccga
cacaacactcacttctttattgagtacttcgccatggacctgctcatggaggacggcgcc
tgtgtcggtgtcgttgcctacaaccaggaggacggaaccctgcatcgattccgagcccac
aagaccgttctggccaccggtggttacggacgagcctacttctcctgtacctctgcccac
acctgtactggtgacggtatggccatggtcacccgagccggccttcccctccaggatctg
gagtttgtccagttccaccctaccggtatctatggctccggctgtctgattactgaggga
tcccgaggtgagggaggatacctgctcaacaagaacggtgagcgattcatggagcgatac
gctcccaccgccaaggatctggcctcccgagatgtcgtgtctcgatccatgaccctggag
atccgagagggccgaggtgttggccagcacggcgaccacatcttcctccagctgtcgcat
ctgcccgcctccgtgctccacgagcgactccccggtatttccgagaccgccgccattttc
gctggtgttgacgttaccaaggagcccatccccgttctccccaccgttcactacaacatg
ggtggtatccccacgcgatacaccggtgaggtccttactcaggatgagaacggtcaggac
aaggttgtcgagggtctgttcgcctgtggtgaggccgcctgtgtctccgtccacggtgcc
aaccgacttggagccaactccctgctcgatctggttgtcttcggccgagccgttgcccac
cgaatcaccgagactcttacccccggtgctcctcttccccctgtctctgctgacattggt
tacgagtccattgctaaccttgacaagatgcgaaacgccgacggtcctctgtccaccgct
accattcgagacaagatgcagcgaaccatgcagatggatgtctccgttttccgaacccag
gagtctcttgaggatggtgtccgaggtatcactgctgttgaccgactcattgaccaggtt
ggtgtcaccgaccgatccatgatctggaacactgatcttaccgagaccctcgagctgcag
aacctgctcacctgcgccatgcagaccgcctactctgccgtcgcccgaaaggagtctcga
ggtgcccatgcccgagaggattaccccgaccgagacgatgtcaactggatgaagcatacc
ctctcctggcaggataagcccggtgacgagatcaagctcggctaccgagccgtccagatg
cacaccctcgatgagtctgagtgtcctaccgtccctcccgccaagcgagtctactaa

DBGET integrated database retrieval system