KEGG   Yarrowia lipolytica: YALI0D23397gHelp
Entry
YALI0D23397g      CDS       T01033                                 

Definition
(RefSeq) YALI0D23397p
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00020  Citrate cycle (TCA cycle)
yli00190  Oxidative phosphorylation
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yli_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0D23397g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YALI0D23397g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YALI0D23397g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-GeneID: 2910329
NCBI-ProteinID: XP_503189
UniProt: Q6C823
LinkDB All DBs
Position
D:3041785..3042591
Genome map
AA seq 268 aa AA seqDB search
MFALRASRNVLKSRPVFARGLASTAEAPKVPAPRIKKFGIYRWNPDTPEKKPELKEYEVD
LSQCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIEGRNTLACLCRINPDIAKE
EKIYPLPHMFVVRDLVPDLTQFYKQYKSIEPYLQRDEVPADGKENLQSIADRRKLDGLYE
CILCACCSTSCPSYWWNQQEYLGPAVLMQAYRWMIDSRDEATAKRQQMLENSMSLYRCHT
IMNCARTCPKGLNPGLAIAKIKRSMAFV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgctccgagcctcaagaaacgttctgaagagccgacccgtgttcgctcgaggc
ctggcctccaccgccgaggcccctaaggtgcctgccccccgaatcaagaagtttggcatc
taccgatggaacccagacacccccgaaaagaagcccgagctcaaggagtacgaggtcgac
ctgtcacagtgtggccccatggtgctggacgcgctcatcaagatcaagaacgagcaggac
cccaccctgacgttccgacggtcgtgccgagagggcatctgtggctcctgtgccatgaac
attgagggccgaaacaccctcgcatgcttgtgccgaatcaatcccgacatcgccaaggag
gagaagatctaccctctgcctcacatgtttgtcgtccgagaccttgtccctgacctgacc
cagttctacaagcaatacaagtccatcgagccctacctgcagcgagacgaggtccctgcc
gacggtaaggagaacctgcagtccattgctgaccgacgaaagctcgacggtctctacgag
tgcattctgtgcgcctgctgctccacctcgtgcccttcgtactggtggaaccagcaggag
tacctgggccccgctgtcctcatgcaggcctaccgatggatgattgactctcgagacgag
gccaccgccaagcgacagcagatgctcgagaactccatgtctctgtaccgatgccacacc
attatgaactgcgcccgaacctgccccaagggtctcaaccccggtctggccatcgccaag
atcaagcgatccatggctttcgtttaa

DBGET integrated database retrieval system