KEGG   Yarrowia lipolytica: YALI0E12133gHelp
Entry
YALI0E12133g      CDS       T01033                                 

Definition
(RefSeq) YALI0E12133p
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli04146  Peroxisome
yli04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:yli00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YALI0E12133g
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YALI0E12133g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YALI0E12133g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 2912814
NCBI-ProteinID: XP_503850
UniProt: Q6C662
LinkDB All DBs
Position
E:complement(join(1474042..1474493,1474790..1474802))
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSKVSGTVTFEQDSESGPVTVTYDIKGNDPNAERGFHVHEFGDNTNGCTS
AGPHFNPFKKNHGGPTDSERHVGDLGNVKTDSEGVAKGVLKDSLLKLTGDNSIVGRTVVI
HGGEDDLGKGGHADSLKTGNAGPRPACGVIGLTA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgttcttcgaggagattccaaggtctccggtactgtcactttc
gagcaggactctgagtccggccccgtcactgtcacctacgacatcaagggcaacgatccc
aacgctgagcgaggattccacgtccacgagtttggtgacaacaccaacggctgcacttct
gccggcccccacttcaaccccttcaagaagaaccacggtggtcccaccgactctgagcga
cacgttggtgacctcggaaacgtcaagactgactctgagggtgttgccaagggtgttctc
aaggactctcttctcaagctgactggtgacaactccattgttggccgaaccgtcgttatc
cacggtggtgaggacgatcttggaaagggtggccatgccgactctctcaagaccggaaac
gctggccctcgacccgcctgcggtgtcattggtcttaccgcctaa

DBGET integrated database retrieval system