KEGG   Yarrowia lipolytica: YALI0E12463gHelp
Entry
YALI0E12463g      CDS       T01033                                 

Definition
(RefSeq) YALI0E12463p
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
yli  Yarrowia lipolytica
Pathway
yli00040  Pentose and glucuronate interconversions
yli00051  Fructose and mannose metabolism
yli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YALI0E12463g
   00051 Fructose and mannose metabolism
    YALI0E12463g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     YALI0E12463g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 PALP
Motif
Other DBs
NCBI-GeneID: 2912835
NCBI-ProteinID: XP_503864
UniProt: Q6C648
LinkDB All DBs
Position
E:complement(1519861..1520934)
Genome map
AA seq 357 aa AA seqDB search
MSSNPSFVLRKPLDLVFEDRPDPKIQDPHSVKVAVKKTGVCGSDVHYYLHGGIGDFIVKA
PMVLGHESAGEVVEVGPEVKDLKVGDRVALEPGVPSRLSQEYKEGRYNLCPCMVFAATPP
YDGTLCRHYIIPEDFCVKLPDHVSLEEGALVEPLSVAVHCNKLAKTTAQDVVIVFGAGPV
GLLAVGVANAFGSSTIVCVDLVPEKLELAKKFGATHTFVPTKGDSPNESADKIRALIKGA
GLSDSPNVALECTGAEPSIQTAVSVLATSGRLVQVGMGKDDVNFPITKCIVKEITVLGSF
RYCHGDYPLAVQLVASGKIDVKKLVTNRFTFKEAEQAYKTAAEGKAIKIIIDGPEEE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaacccgtcatttgttcttcgaaagccattggatctcgtctttgaggatcgg
cccgaccccaagatccaggacccccactccgtcaaggtggcagtcaaaaagaccggagtt
tgcggctcggatgtccactactatctgcatggaggaatcggcgacttcattgtcaaggct
cccatggttctaggccatgaaagtgccggagaggtggttgaggttggtcctgaagtcaag
gacctcaaggtgggagatcgagtggctctcgagcccggagtgccgtctcgattgtcacag
gagtacaaggagggacgatacaacctgtgtccttgcatggtgtttgctgccacccctccc
tacgacggtactctgtgtcgtcactacatcattcccgaggacttttgtgtcaagctgcct
gatcatgtgtctctcgaggagggagctcttgtggagcctctgtccgtggctgtccactgc
aacaagctggccaagaccactgcccaggacgtggttattgtgtttggagctggcccagtc
ggactgctagccgtgggagtggccaatgcctttggatcatctaccattgtgtgtgttgat
cttgttcccgagaagctggagctcgccaagaagttcggtgccactcatacgtttgtaccc
actaagggagacagtcccaacgagtctgctgacaagatccgagctctgatcaagggcgct
ggtctctctgactcgcccaatgtggctttggagtgcaccggagctgagccttctattcag
actgctgtttctgtgctggccacttccggtcgacttgtgcaggtcggcatgggcaaggat
gacgtcaacttccctatcaccaaatgcattgtaaaggagattaccgtgctcggatcgttc
cgatactgccatggtgactatcccctggctgttcagctggttgcttctggcaagattgac
gtcaagaagctggtgaccaaccggttcaccttcaaggaggctgagcaggcgtacaagacg
gcggccgagggcaaggccatcaagatcatcattgacggtcccgaggaggagtag

DBGET integrated database retrieval system