KEGG   Yarrowia lipolytica: YALI0E15488gHelp
Entry
YALI0E15488g      CDS       T01033                                 

Definition
(RefSeq) YALI0E15488p
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00051  Fructose and mannose metabolism
yli00052  Galactose metabolism
yli00500  Starch and sucrose metabolism
yli00520  Amino sugar and nucleotide sugar metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0E15488g
   00051 Fructose and mannose metabolism
    YALI0E15488g
   00052 Galactose metabolism
    YALI0E15488g
   00500 Starch and sucrose metabolism
    YALI0E15488g
   00520 Amino sugar and nucleotide sugar metabolism
    YALI0E15488g
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YALI0E15488g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:yli04131]
    YALI0E15488g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     YALI0E15488g
Membrane trafficking [BR:yli04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    YALI0E15488g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 2912006
NCBI-ProteinID: XP_503983
UniProt: Q6C5S9
LinkDB All DBs
Position
E:1841513..1842952
Genome map
AA seq 479 aa AA seqDB search
MTITLSQKVGEFASEFAIDGSYVQQGVKHFVDQTAQALSANMERAMPMIPSFVTRIPTGK
EKGVQLAVDLGGTNFRVSSVHLNGDHTHKTVASKVAVSDDLMTGTQADFFGFLAQQVKDF
LTEHHSEHFSQTEPLRMGVTFSFPVNQVALDKGYLLRWTKGYDIKDAVGKDVVELFQIQL
DALDLNVKIVALVNDTVGTLLARAYASKSDDGKHKQTLIGAIFGTGTNGAYSERLKRVPK
FTAANYPEVFKRYSPEHIANQTMIINTEWGSYDNDIDVLPNTKWDIDLDENTHNKSFHMF
EKRISGMFLGELLRLCLLDLKSEGLLLQSTKLEGNPVWKGFGMDTSVLSFIEAATEAQIE
TGKGDYEKIIKAMGLAAKDITPEQVAALKPLVTAIGRRSAYLSAIPLAAITLHTHALEKF
DVVDIGVDGSVFQFYPKFADMVKEAMGYVEGISVDRIDIGHAEDGSGVGAALAAYPDDS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcactctgagtcagaaggttggcgagttcgcctccgagttcgccatcgatggc
agctatgttcagcaaggcgtcaaacacttcgtcgatcagacagcacaggccctctcagca
aacatggaaagagcaatgcccatgattccctcgtttgtcacccgaattcccacagggaag
gaaaagggtgtccagttggcagttgacctgggaggcactaacttccgggtctcatccgtg
cacctgaatggtgaccacacccacaaaacggtggcatcaaaagttgctgtcagcgatgac
ctcatgactggcactcaagctgacttctttggatttttggcccagcaagtgaaagatttc
ttaacagaacaccactcagaacatttcagccagactgagcctttgcgaatgggagtgacc
ttctcgttccccgtcaatcaggtagctttagacaagggctatcttttgagatggaccaag
ggttatgatatcaaggatgctgttggaaaagacgtcgtggagctatttcagatccagctc
gatgctcttgacctgaatgtgaagattgtggctctggtcaacgacaccgtgggcacacta
ttggcgcgagcttacgcctctaaatccgacgatggtaagcataagcagaccttgatcggc
gcaatctttggcaccggaaccaatggtgcttactcagaaagacttaagcgggtccccaag
tttaccgctgcgaattaccctgaagttttcaagcgctactcaccagagcacatcgcgaac
caaactatgattatcaataccgagtggggatcttacgataatgacattgacgtcctccca
aacaccaaatgggatattgacttggacgaaaacactcacaacaagtcttttcacatgttt
gaaaagcggatttctggaatgttcctgggtgagctgttgcggctctgtcttttggatttg
aagagtgagggcctacttcttcaatccacaaagttggaaggaaaccctgtttggaaggga
tttggaatggacacttcggtcttgtcattcattgaagcagccactgaggcacagatcgag
acaggaaagggcgactatgagaaaatcatcaaggccatgggtctggccgccaaggacatc
actcctgaacaagttgctgccctgaaacccctggttacggctattggtagacgatctgcg
tatctatctgccattcctttagctgccattactcttcatactcacgctttggagaaattc
gacgttgttgacattggagttgacggttctgtcttccagttttaccccaaatttgctgat
atggtgaaagaagcgatgggctatgtcgagggtatttctgttgaccgtatcgacatcggc
cacgcagaagatggctcaggggtgggagctgccttggctgcttacccggacgactcatag

DBGET integrated database retrieval system