KEGG   Yarrowia lipolytica: YALI0E22935gHelp
Entry
YALI0E22935g      CDS       T01033                                 

Definition
(RefSeq) YALI0E22935p
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
yli  Yarrowia lipolytica
Pathway
yli04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:yli00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YALI0E22935g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:yli03036]
    YALI0E22935g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YALI0E22935g
Chromosome and associated proteins [BR:yli03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     YALI0E22935g
   HDAC complexes
    Sin3A-HDAC complex
     YALI0E22935g
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    YALI0E22935g
  Chromatin remodeling factors
   NuRD complex
    YALI0E22935g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 2912919
NCBI-ProteinID: XP_504286
UniProt: Q6C4X6
LinkDB All DBs
Position
E:complement(2703629..2705005)
Genome map
AA seq 458 aa AA seqDB search
MVFTQEPFDPITVKPNEKKRVAYFYDSDVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKH
MEIYRAKPATKQEMCQFHTDEYVDFLSRVTPDNMEHFAKEQAKFNVGDDCPVFDGLFEFC
GISGGGSMEGAARLNRGKCDIAINWAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGAGKGKNYAVNFPLRD
GIDDTNYKNVFQPVIKAIMEWYQPTVVVLQCGGDSLSGDRLGCFNLSMQGHANCVNYVKS
FGLPVLVVGGGGYTMRNVSRTWTFETGLLLNKMVGPDIPYNDYYEYYGPDYKLEVRPSNM
QNANSPEYLDKILTQVLVNLGRTKFAPSVQMTDVPRDAPDDGDEEEDSAKAKDTKGGSQM
AIDEQIEHPNEFYDDDNLEGGDAKDINNFKDKDVAMED
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtatttacgcaagagccgtttgaccccatcacggtcaagcccaacgaaaaaaaacgg
gtggcgtacttctacgactcggatgtcggcaactacgcctacggcgccggccaccccatg
aagccccacagaatacgaatggcccactcgctcatcatgaactacggtctctacaagcac
atggagatctaccgggccaagcctgccaccaagcaggaaatgtgccagttccacacggac
gagtacgtcgatttcctgtcgcgcgtcactccggacaacatggagcactttgctaaggag
caggcaaagttcaacgtcggagacgattgtcccgttttcgacggtctgtttgaattctgc
ggaatttccggcggaggatctatggagggagccgcccggcttaacagaggcaagtgtgat
attgccatcaactgggccggaggactccatcacgcaaagaaatccgaggcgtccggattc
tgctacctcaacgacattgtgctgggcatcatcgagctgctcagataccacccccgagtc
ctgtacattgatatcgacgtgcaccacggagacggagttgaggaggctttttacaccacg
gaccgagtcatgacgtgctcgttccacaagtacggagagtttttccccggtacaggtgag
ctgcgggacatcggagccggaaagggcaaaaactacgcagtcaacttcccgttgcgagac
ggaatcgacgacacaaactacaaaaacgtgttccagcccgtcatcaaggccatcatggag
tggtaccagcccactgtcgttgtcctgcaatgcggtggtgactcgctgtcgggtgaccgt
cttggatgtttcaacctgtccatgcagggtcatgccaactgcgtcaactacgtcaagtcc
tttggtttgccggttctggtggtcggaggaggaggctacacaatgcgaaatgtgtcaagg
acgtggacttttgagaccggtctgcttctcaacaagatggtgggcccggatatcccctac
aacgattactacgaatactacggacccgactataagctcgaggtgcgaccttctaacatg
cagaatgccaactctcccgagtacctggacaagattctcacccaggtgcttgtcaacctt
ggtcgaaccaagtttgcaccttctgtgcagatgaccgatgtgccccgagacgctcctgat
gatggagatgaagaggaggactcggccaaggccaaggacactaagggcggctcccagatg
gccattgacgagcagattgagcaccccaacgagttttacgacgacgataacctcgagggt
ggagatgccaaggacatcaacaacttcaaggacaaggatgtcgccatggaggactaa

DBGET integrated database retrieval system