KEGG   Yarrowia lipolytica: YALI0E33517gHelp
Entry
YALI0E33517g      CDS       T01033                                 

Definition
(RefSeq) YALI0E33517p
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
yli  Yarrowia lipolytica
Pathway
yli00020  Citrate cycle (TCA cycle)
yli00310  Lysine degradation
yli00380  Tryptophan metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Module
yli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YALI0E33517g
  09105 Amino acid metabolism
   00310 Lysine degradation
    YALI0E33517g
   00380 Tryptophan metabolism
    YALI0E33517g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     YALI0E33517g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 2912855
NCBI-ProteinID: XP_504734
UniProt: Q6C3M8
LinkDB All DBs
Position
E:join(3975215..3975406,3976175..3978997)
Genome map
AA seq 1004 aa AA seqDB search
MLRHALLKRTPVLPRLTSRKAFVPLIQKRKYSDDVFLTTNAANYIDEMYAAWKDDPKSVH
VSWQSYFKNLDGGLPADKAFSAPPTIVPSPSGGVPTPAAPSGAPSDITNHMKAQLLVRAY
QVRGHTKAKIDPLGISFGSDKNKKPPKELTLEFYGWTDKDLDTEITLGPGILPRFVENGK
NKRTLREIIMDCERIYCGSYGVEYIHIPSREECEWIRDRVETPKPYNYTPDQKRRMLDRL
IWANLFETFLASKFPNDKRFGLEGAETVVVGMKTLIDRSVDAGIEDIVIGMPHRGRLNML
SNVVRKPNESIFAEFQGSAVFDEGSGDVKYHLGANYQRPTPSGKKVNLSLVANPSHLEAE
DPVVLGKTRAIQHMKHDVGTFDKAMGVLMHGDAAFAGQGVVYETMGMHSLPAYSTGGTIH
IIVNNQIGFTTDPRFSRSTPYPSDLAKSIDAPIFHVNADDMEAVDFIFNLAADWRATFKS
DVIIDLVCYRKFGHNETDQPSFTQPLMYKKIADKPNPLDIYVDKLLKEKTFTKEDIEEHK
QWVWGMLEESFKKSKDYVPHQKEWLASPWDDFKTPKELATEILPHLPTSVEEKKLKEIGK
VISSVPEGFTLHRNLKRILSNRGKSVEEGHGIDWSTGEALAFGTLLEEGHHVRLSGQDVE
RGTFSQRHAVVHDQVNETTYVPLNHLTKDQADFTVSNSHLSEYGVMGFEYGYSLASPEAL
VIWEAQFGDFANTAQVIIDQFIASAETKWSQRSGLVLSLPHGYDGQGPEHSSGRIERYLL
LGNEDPLHFPSPDKLERQHQDCNIQIAYPTTPANIFHLYRRQMHRAFRKPLACFFSKNLL
RNPMAKSDLSEFVGESHFQWVIEDDQHGKTINNKEGIERVLFCSGQVWTALFKRREDLAD
KKTAIIRIEQLHPFPWEQVRELLDSYPNLKDICWAQEEPLNAGAWVHIQPRMYTTFQATK
NHKHAHIRYAGRKPSASVAAGTKKLHLAEEEALLKQAFQQEDKA
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgctcagacacgctttattgaaaaggacccccgtcctcccgcgactcacaagtcgcaag
gccttcgtgccattgatccagaaacgaaagtactctgatgacgtcttccttaccaccaac
gccgcaaactacatcgatgagatgtatgccgcatggaaggacgaccccaagagtgtccac
gtctcttggcagtcttacttcaagaacctggatggtggccttcctgccgacaaggcattc
tctgcccctcccactattgtgccctctccctctggaggtgttcccacccccgctgccccc
tccggcgctccttctgacatcaccaaccacatgaaggcccagctgctggttcgagcctac
caggtccgaggtcacaccaaggccaagattgatcctcttggaatctcctttggctccgac
aagaacaagaagccccctaaggagctgaccctcgagttctacggatggaccgacaaggat
ctcgacaccgagatcactctcggccccggtatcctcccccgattcgtcgagaacggtaag
aacaagcgaactctccgtgagattatcatggactgtgaacgaatctactgtggctcctac
ggtgttgagtacatccatattccctctcgagaggagtgtgagtggatccgagaccgagtc
gagacccccaagccttacaactacacccctgaccagaagcgacgaatgctcgaccgactt
atctgggctaacctcttcgagaccttccttgcctccaagttccccaacgacaagcgattc
ggtcttgagggtgccgagactgtcgttgtcggtatgaagactctgatcgaccgatccgtc
gatgccggaatcgaggacattgttatcggtatgccccatcgaggtcgactcaacatgctt
tccaacgttgtgcgaaagcccaacgagtccattttcgctgagttccagggatctgctgtc
ttcgacgagggttctggagatgtcaagtaccatctgggtgccaactaccagcgacccacc
ccctctggaaagaaggtcaacctctctcttgtcgctaacccctcacatcttgaggctgag
gaccccgttgtcctgggtaagacccgagctatccagcacatgaagcatgacgtcggcacc
ttcgacaaggccatgggtgtgctcatgcacggtgacgctgcctttgccggccagggtgtt
gtctacgagaccatgggcatgcactctctgcctgcctactctaccggtggaaccatccac
atcatcgttaacaaccagattggtttcaccaccgatcctcgattctcccgatctaccccc
tacccctccgatctggctaaatccatcgatgcccccatcttccacgtcaacgctgacgat
atggaggccgtcgacttcatcttcaacctggctgctgactggcgagctaccttcaagtcc
gatgtcatcatcgatcttgtctgctaccgaaagttcggtcacaacgagaccgatcagccc
tcgttcactcagcctctcatgtacaagaagattgccgacaagcccaaccctcttgacatc
tatgtcgacaagcttctcaaggagaagacttttaccaaggaggacattgaggagcacaag
cagtgggtctggggaatgctcgaggagtctttcaagaagtccaaggactacgtgccccat
cagaaggagtggctcgcttctccttgggacgacttcaagacccccaaggagcttgccacc
gagatcctgccccatctccccacatctgttgaggagaagaagctcaaggagattggaaag
gtcatctcctctgttccggagggattcacccttcaccgaaacctcaagcgaatcttgtcc
aaccgaggcaagtccgttgaggagggccatggcattgactggtccactggtgaggctctt
gccttcggtactctgcttgaggagggccaccacgtccgactttccggtcaggatgtcgag
cgaggtaccttctctcagcgacacgctgttgtccacgaccaggttaacgagaccacatat
gttcctctgaaccacctgaccaaggatcaggccgacttcaccgtctccaactcccatctt
tccgagtacggtgtcatgggctttgagtacggttactccctggcttctcctgaggccctt
gtcatctgggaggctcagtttggtgacttcgccaacactgcccaggtcatcattgatcag
ttcattgcctccgccgagaccaagtggtctcagcgatccggcttggttctgtctctgccc
cacggatacgatggacagggtcccgagcattcttccggacgaattgagcgatacctgctg
ctcggaaacgaggatcctctccacttcccctctcccgataagcttgagcgacagcaccag
gactgcaacatccagattgcttaccccactacccccgccaacatcttccatctgtaccga
cgacagatgcaccgagctttccgaaagcctctggcctgcttcttctctaagaacctgctg
cgaaaccccatggccaagtccgacctctctgagtttgttggtgagtctcacttccagtgg
gtcattgaggacgaccagcatggcaagaccatcaacaacaaggagggcatcgagcgagtt
ctcttctgttccggccaggtctggactgctctcttcaagcgacgagaggatcttgctgac
aagaagactgctatcatccgaatcgagcagctgcaccccttcccttgggagcaggtccga
gagcttctggactcttaccccaaccttaaggatatctgctgggctcaggaggagcctctt
aacgctggtgcctgggtccacatccagcctcgaatgtacaccaccttccaggctaccaag
aaccacaagcatgcccacattagatacgctggccgaaagccttctgcatctgttgctgcc
ggtactaagaagctgcatcttgctgaggaggaggctcttctgaagcaggctttccagcag
gaggataaggcctaa

DBGET integrated database retrieval system