KEGG   Yarrowia lipolytica: YALI0F08415gHelp
Entry
YALI0F08415g      CDS       T01033                                 

Definition
(RefSeq) YALI0F08415p
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yli  Yarrowia lipolytica
Pathway
yli00250  Alanine, aspartate and glutamate metabolism
yli00410  beta-Alanine metabolism
yli00430  Taurine and hypotaurine metabolism
yli00650  Butanoate metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
Module
yli_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:yli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YALI0F08415g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YALI0F08415g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YALI0F08415g
   00430 Taurine and hypotaurine metabolism
    YALI0F08415g
Enzymes [BR:yli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YALI0F08415g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 2908500
NCBI-ProteinID: XP_505160
UniProt: Q6C2F2
LinkDB All DBs
Position
F:1182607..1184241
Genome map
AA seq 544 aa AA seqDB search
MVLSEHVNADKLLSNLTGKGDEHAIRALIASHTLRDPYSSKYNSQEPIPKFRIPEEGCEE
KQAYQLIKDDLDLDGKPNLNLASFVNTYISDRAEKLAVENLTKNLADADEYPALMTVHAR
CVSILGHLWNNTDHEKAIGTATTGSSEAIHLGGLAMKKRWQEKRRAAGKSTEKPNILMAA
NAQVALEKFARYFDVEDRIIPVREASKHCLDLSKIKENLDENTIGIFVIMGSTYTGHYED
VQGVAKILDEYEKETGHSIDIHVDGASGAMVAPFLYPDLEWDFRVPRVKSINTSGHKFGL
TTAGLGWILWRDAKYLPKELIFELHYLGGKEESYTLNFSRPGFPVLHQYYNFLHLGFDGY
KQLHASSMANARLLSVFLEATGHYTCVSEIHLPANGSKPKDVKHVATADPLQYMAGLPVV
AFRFSDSFRKAHPEVPQAAVSTLLRVKGYIIPNYELPPSEQKTEILRVVVRQSMSIDLLD
RLMEDISAITNVLLEAVEDVKKLRAEGDHDPQLIHKYVLTLVTGKPVEEREEDWEGHSTF
RAAC
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctccgaacacgtcaacgccgacaagctgctgtccaacctcaccggcaagggt
gacgagcacgccatccgggctctcattgcctcccacaccctgcgagacccctactcatcc
aagtacaactcgcaggagcccattcccaagttccgaattcccgaggagggctgcgaggag
aagcaggcctaccagcttattaaggatgacctggatctcgacggaaagcccaacctcaac
ctggcttctttcgtcaacacctacatctccgaccgagccgagaagctggccgtggagaac
ctgaccaagaacctggccgatgccgacgagtaccccgctctgatgaccgttcacgcccga
tgtgtctccattctcggccatctctggaacaacaccgaccacgagaaagctatcggtact
gccaccaccggatcttccgaggccatccatcttggaggtctggccatgaagaagcgatgg
caggagaagcgacgggccgccggcaagtccactgagaagcctaacattctcatggctgcc
aacgcccaggtcgccctcgagaagtttgcccgatactttgatgtcgaggaccgaatcatc
cccgtgcgagaggcctccaagcactgcctcgatctgtccaagatcaaggagaacctcgat
gagaacaccattggtatcttcgtcatcatgggatccacctacactggccactacgaagac
gtccagggcgtcgccaagattttggatgagtacgagaaggagaccggtcactccattgac
atccacgttgacggagcctccggagccatggttgcccctttcctctaccccgatctcgag
tgggacttccgagtgccccgagtcaagtccatcaacacctctggccacaagtttggtctc
acaaccgctggtcttggttggattctctggagagacgcaaagtacctgcccaaggagctc
atcttcgagctgcactacctgggaggtaaggaggagtcctacaccctcaacttctcgaga
cccggtttccccgtgctgcaccagtactacaacttcctgcacctgggattcgacggctac
aagcagctgcatgcctcttccatggctaacgcccgactgctatctgtcttcctcgaggct
actggacactacacttgcgtctccgagatccacctgcctgctaatggctccaagcccaag
gatgtcaagcacgtggctactgccgatcctctgcagtacatggctggtctgcccgttgtt
gccttccgattctccgactcgttccgaaaggcacatcctgaggtcccccaggctgctgtc
tccaccctgctacgagtcaagggatacattatccccaactacgagctgcctccttccgag
cagaagactgagattcttcgagtggttgtgcgacagtccatgtccatcgacctgctcgac
cgactcatggaggacatttccgccatcaccaatgtgctgctcgaggccgtggaggatgtg
aagaagctgcgggccgagggtgaccacgatcctcagctcattcacaagtacgttctgact
ctggtgaccggaaagcctgttgaggagcgagaggaggactgggagggacactccactttc
cgagctgcctgttaa

DBGET integrated database retrieval system