KEGG   Yarrowia lipolytica: YALI0F18403gHelp
Entry
YALI0F18403g      CDS       T01033                                 

Definition
(RefSeq) YALI0F18403p
  KO
K12158  ubiquitin-like protein Nedd8
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:yli04121]
    YALI0F18403g
Ubiquitin system [BR:yli04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   YALI0F18403g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF5082
Motif
Other DBs
NCBI-GeneID: 7009633
NCBI-ProteinID: XP_002143115
UniProt: B5RSL8
LinkDB All DBs
Position
F:complement(join(2446209..2446376,2446582..2446611,2446713..2446730,2446849..2446866))
Genome map
AA seq 77 aa AA seqDB search
MKIKIKTLIGKEIEMDVEPEDQISVLKEKIEELEGIPPAQQRLVFTGKQLQDEKTIAENK
IEAGASLHLVLALRGGN
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaagatcaagacactcattggaaaggagattgagatggacgttgagcccgaa
gatcagatctccgttctcaaggagaagatcgaggaactcgagggtattcctcccgcccag
cagcgtctcgttttcaccggaaagcagctccaggacgagaagaccattgcggagaacaag
attgaagctggagcctctctgcatctggtcctggcccttcgaggcggcaactaa

DBGET integrated database retrieval system