KEGG   Yarrowia lipolytica: YALI0F18414gHelp
Entry
YALI0F18414g      CDS       T01033                                 

Definition
(RefSeq) YALI0F18414p
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
yli  Yarrowia lipolytica
Brite
KEGG Orthology (KO) [BR:yli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:yli03012]
    YALI0F18414g
Enzymes [BR:yli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     YALI0F18414g
Translation factors [BR:yli03012]
 Eukaryotic type
  Release factors
   YALI0F18414g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 GCD14
Motif
Other DBs
NCBI-GeneID: 2907832
NCBI-ProteinID: XP_505577
UniProt: Q6C185
LinkDB All DBs
Position
F:2446989..2447636
Genome map
AA seq 215 aa AA seqDB search
MSFPTPSTSSANYEEVYEPSEDSFMLLDVLEMEQSYINSHLSYPVVTEIGTGSGIVTTFM
LKSVVPKGVFLATDISPFACNQVLATSKENNGTQYLEALRGERTTMMRPHTIDLLVFNPP
YVPDDKPVEPYPETDGDWVDWALLGGEDGMQVTWKVLLELKTILSKNGIAYILFCASNKP
EQVAVKMRELGWIVTRIVERKEGRELLSVYRFELK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttccaacaccttccacgtcatcagccaactatgaagaggtctacgagcccagc
gaagactccttcatgctcctggacgtgctggaaatggaacagagctacatcaacagccat
ctgtcataccctgtggtgacagagatcggaaccggatcaggcatcgtcaccaccttcatg
ctgaaatccgtggtgcccaaaggcgtctttttggctacagatatcagcccctttgcatgc
aaccaggttctggccacgtcaaaagaaaacaacggcacccagtacctcgaggcgcttcgt
ggagaacgtaccacaatgatgagacctcataccatcgatctactggtcttcaaccctcca
tatgtgccagacgacaagcccgtagaaccctacccggagacagatggtgactgggtcgat
tgggcacttcttggaggtgaagacggaatgcaggtgacttggaaggtgctactagaactg
aagaccatactgtcaaagaacggaatcgcctacattttgttctgtgcaagcaacaagcca
gaacaagtggctgtcaaaatgagggaactgggatggatcgtgacgcgcattgttgaaaga
aaagaaggcagggaacttctaagtgtctacagattcgagctgaagtag

DBGET integrated database retrieval system