KEGG   Yarrowia lipolytica: YALI0F18436gHelp
Entry
YALI0F18436g      CDS       T01033                                 

Definition
(RefSeq) YALI0F18436p
Organism
yli  Yarrowia lipolytica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N BDHCT
Motif
Other DBs
NCBI-GeneID: 2907833
NCBI-ProteinID: XP_505578
UniProt: Q6C184
LinkDB All DBs
Position
F:complement(join(2447722..2452544,2452735..2452786))
Genome map
AA seq 1624 aa AA seqDB search
MFRSISPLPFWSKDATQDPKMKKYTSALEKALALWDSVDEWADYISFIGKLQKALKSHSN
PSYLPLQSEIASKLAWCLLPNLPSGVHQKTLEVYRQVFEILRGIGDYHKSLDGKSVDPVA
QGIRVWLPGLLPLMAYASINVKPILIEVLQEDIVEKLPQATLKTTIRPLLLSLLPGIDDE
SSESFQACFDLIQKLKLRLHDEPYFWQCFFLTIVSAPDKRQGALVYAYKELPQFSKVEGI
NESDKIIHSLSYEAQSAVTPECGLLIRAFCRGLEDDQLLVQRGFLELLVKNLPLDSPVIT
GLASKSDISLLMTSACAAVLRKDMSLNRRLWAWLLGPDDVSMKEYFTTHGRDALVQGILA
LSSPVRASKISLSLMDRWEIGSTVIPEILTPIIQSVYDCEKRPDYQDIVLSASAFVDSVE
AINIWADIQKMLKTGSLSLALFTLQTFNLSDEEMIVKHAPLALLSHLLSGRFSQWKEWNE
IATLLIELIPERAFLPVEHSTLTDGDFQVSTIESKVEEYYDGEWADGYGAADVYLLLLQT
STRLADEFFQKVTAECSNNPAIFSKLALIISELQAKQVSGFKSEQLEKTLQLAGEEAVAQ
FDPFSSSPLPSLPPVAVLGWTRLYPLFPANLLALVGYIFTSLTPNSQYYNGPFHNAELVK
ALWSLQAVHGSDDREVEAALSILFSKPCDEKSQVFSAIWQHSLSAPNFSKLLARPLFLYL
DLLPLPTSQLELYGSNAGKNKFLASDVSSNELISLAFASEKSLAGSYWLNTVASSGSCDK
LFSLLLDPLSKSAFFSRPTVEGKLLFEESDDLALFAYHVSALTKVLSANNSSMAKFHFNK
EEVEEFDINDYYEGKSTYAAWTANLMAHFLQFQAVDTLAYSSALSAVLKLCSILLDSPLF
PTSKANWEVFVRVLVTKLSDLVNQDSELQVIVLAVLAKALQASDLSMTLSKSEKFIGNGP
VDIPLVSETSDVNIPGVFIAVVLHGLSSRKGVIISSGWIHFLECLLGIYSTDLFQISIAI
VERLCALVDGTPVASLQKLSTGSREVLVEVDDKDGEKDPAVGDTVTDVTAPLSDSIIPYL
TGLEYCLESLYLAYTKVEASQEELNLNSTGWMTNVVNGVLSLEEPTKGNGYRMIVLLCFQ
NAVKSCFNLWRKVDGQEAEEYTLDSVVYLGQRLKFRARKILDKLFSFERGEVLQMLIELS
EDDMPHVLKVLHVLDGSRPKLSVSQLLQSLSDDQKKSTASFLLAYVKSLSNDAVEDIYSD
YMGFARTVMLNPVPYKEILSPTVQTLTIIGVKIDGSNFANRKVSKEISDAVVKLVGQVTD
EQTLMKVVPVLRTILIDQDKVSSVLQGIVNNVVIPKRSFELLGVITQIPGTVKVWKSAVH
DFFIEDNFVYEAPWPQILSKWSTCTKEVSELITGSSGVFNWGSRGNSVRRLCYLLLSGQE
DQFVLHMKEIKGILDEIELESLFIALRAIVMRFSATHLVPIWPLVAHNLQVIFEGLLQGK
ETDNRIVMSACKLLDLVLVLNQEDFQLDQWLFVTDSSDAIYGHPYGILDQLAESTPVSSD
DLHLEETSKRRPLLFGQKIGSLTSLAQLKPFFDRLSIYNYESVYALKETDQEACELDLLA
DIQE
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggtcaatatcgccattgccattctggtccaaggatgcgacccaagacccaaaa
atgaagaaatacacgtcagcactagagaaggcgctggctctatgggactcggtcgacgaa
tgggcagactacatttcgttcattggcaagctgcagaaagcactcaagagccattccaac
ccatcctacctgccgctacagagcgaaattgcctccaaactggcctggtgtctgctgcca
aacctgccgtcaggagtgcaccagaagaccctggaggtgtaccgtcaggtgtttgagata
ctgcgaggtatcggcgactatcacaagagtctggacggcaaatcggtggaccccgtggcc
cagggaatcagagtctggctccccggactgctcccgctcatggcatatgcatccattaac
gtcaagcccatcttgattgaggtacttcaggaggacattgtggagaagctgcctcaagcg
actctcaaaacgacaattcgaccgctgctgctctcactgcttcccggtatcgacgacgag
tcaagtgagtcattccaggcgtgctttgatctcattcagaagctcaagctacgtctccat
gatgagccctacttttggcaatgcttcttcctcaccattgtatccgctccagataagagg
caaggagcgctggtttatgcatacaaagaactgccccagttctccaaggtcgagggcatc
aatgaatccgacaagatcattcacagtctatcctacgaagcccagtcagctgtcactccg
gaatgtggcctgctgatccgggccttctgtcgggggctagaggacgaccaactccttgtc
cagcgaggttttctggaactattagtcaagaacctgcctctcgattctcctgtcattaca
ggcctggcctctaagagcgacatttctctgctgatgacaagcgcgtgtgccgccgtgctc
agaaaggacatgtctctcaaccgaaggttgtgggcctggcttcttggacccgatgatgtt
tccatgaaggagtactttacaacacacggccgagatgcgcttgtccagggcatcctggct
ctgagttcgccagtgagagcttccaagatttctctctcgttgatggatcgatgggaaatt
ggatctactgtgattccagagattctgacacccattatccaatctgtctacgactgtgaa
aagagacctgactaccaggatattgtgttgtcagcctccgcctttgttgactcagtggag
gcaatcaacatttgggccgacattcaaaagatgctcaagactggctctctatctttggct
ttattcacacttcaaaccttcaatctttcggacgaagagatgattgtcaagcatgctcct
ttggcactactgagccatcttctgtctggacgtttttctcagtggaaagagtggaacgag
attgctactctgttgattgaactcatccccgagcgggcatttttaccagtggaacattcg
acgctcactgatggcgatttccaagtgtccactattgagtccaaggtcgaagagtactac
gatggcgagtgggccgatggatatggagctgctgatgtttacttgttgcttctacagacc
tccactcgcttggctgatgagttcttccagaaggtcactgctgaatgtagtaataaccca
gccatcttctccaagcttgcactcatcatttccgagctacaagccaagcaggtttctggt
tttaagtctgaacagctggaaaaaactctacagctggcaggtgaagaagcagtggctcaa
ttcgaccccttctccagctctcccctgccttctctgcctcccgtggctgtcctgggatgg
accaggctgtacccgctgttcccagcgaatcttcttgctctggtaggatacattttcaca
tcattaacccccaactcacagtactacaacggccctttccacaatgcagagctggtcaag
gcgttgtggtctcttcaggctgttcacggtagcgatgacagggaagtggaggctgctctg
agtattctgttttcgaaaccctgtgatgagaagtcacaagtgttttcggctatttggcag
cactctctttcggcacccaacttctccaagttattggctcgacccttgttcctgtatctc
gacttgcttcctcttcctacctctcagttggagctctatggcagcaatgcaggcaaaaac
aaattcctcgcctctgatgtgtcgtccaatgagctgatttccctggcttttgcatcggag
aaatctcttgctggctcttactggctcaacacagtggcttcgagcgggtcgtgtgataaa
ctattctcacttctcctagaccctctgtccaagtccgcatttttcagccggccaaccgtt
gaaggcaagctgctgtttgaagagtccgatgacctggctcttttcgcataccacgtctca
gctctcacgaaggttctttctgccaataattctagcatggccaaattccatttcaacaag
gaggaggtggaagaatttgacatcaacgattactatgaaggcaaatccacctatgccgct
tggactgccaacctgatggctcattttctgcaattccaggctgttgatacgctggcatac
agttcagctctgtctgcagtgctcaagctgtgttccattctgcttgattcgcctctcttc
cctacttccaaagccaattgggaggtatttgtgcgcgtgttggtgactaagctgtctgac
ttggtaaaccaggactcggagcttcaggtcatcgtgcttgcagttcttgccaaggctctg
caggcctcggatctttccatgacgctttccaagagcgaaaagttcattggaaacggtcct
gtggacatccccttggtgtctgaaacctcagatgtgaacattcccggtgtttttattgct
gttgttctgcatggcttgtcttctcgaaagggcgttatcatcagttcgggatggattcac
ttcctagagtgtctgctcggaatctactctactgatttgttccagattagcattgctatc
gtcgagagactgtgtgctcttgttgatggtacccccgttgcttctctgcagaagctttct
acaggctccagggaggttctggtcgaagttgacgacaaggacggcgagaaggaccctgca
gttggcgatacagtcactgatgtcacggcacctctgtctgactccattattccttacctg
acaggtctggaatactgtctcgagtccctttatcttgcttacaccaaggtcgaggcttcg
caggaggaactaaatctcaactccacggggtggatgaccaacgtggtcaatggtgtctta
tctctggaggagcctacaaagggcaatggctacagaatgattgttctgttgtgtttccag
aatgccgtcaagagctgcttcaatctgtggcggaaggtcgatggacaggaggccgaggaa
tacactttggacagcgttgtctaccttggccagcggttgaaattccgagctcgaaaaatt
ctcgacaagctgttctctttcgagcgaggtgaggttcttcaaatgctgatcgagctttcg
gaggatgatatgccccatgtgttgaaggtattgcatgttctggatggctctcggcccaag
ctgtcggtgagccagttgcttcagagtctctcagatgaccagaagaagtcaacggcctcg
ttccttttggcttatgtgaagtctctatccaacgacgctgtagaggacatttactcggac
tacatgggtttcgcccgaaccgtcatgctgaaccccgtgccctacaaggaaatcttgtct
cccaccgttcagaccctcactattattggagtcaagattgatggcagcaactttgccaac
cgaaaggtgagcaaggaaatctctgatgctgttgtgaagctggtcggacaggttaccgat
gaacagactctcatgaaggtggttcctgttctgcgaacgattctcattgaccaagacaag
gtgagttccgttttgcagggcattgtgaacaacgtcgtgatccccaaacggtcttttgag
ttactcggcgtcatcactcagatcccaggaaccgtcaaggtgtggaagagtgccgttcac
gactttttcatcgaggacaactttgtctacgaggctccctggccccagattctgtccaag
tggtccacgtgcaccaaggaggtttctgagctcatcaccggctcatctggtgtcttcaac
tggggctctcgaggtaacagtgttcgacgtttgtgttacctgttgctttctggccaggaa
gaccagtttgtgcttcatatgaaggagatcaagggcattctggatgagattgagctcgag
tccttgttcattgcactgcgtgctattgttatgcggttctctgccactcatctggttccc
atttggcctctggttgcccacaacctgcaggttatattcgagggtctgctgcaaggtaag
gagacggataaccgaatcgtgatgagtgcctgtaagctgctcgatcttgtgctggtgctt
aaccaggaggatttccagctggatcaatggctgtttgtcaccgattccagtgatgctatt
tacggacacccttacggtattctggatcagttggctgagtctacgcctgtcagcagtgat
gatcttcatctggaggagacttccaagcgacggcctttgctttttggacagaagattggt
tctcttacctctcttgcacagctaaagcctttctttgaccggctctccatttacaactac
gaaagtgtttacgctctcaaggagactgatcaggaggcttgtgagctggatctcttggcc
gatatccaggagtaa

DBGET integrated database retrieval system