KEGG   Yarrowia lipolytica: YALI0F18480gHelp
Entry
YALI0F18480g      CDS       T01033                                 

Definition
(RefSeq) YALI0F18480p
  KO
K13341  peroxin-7
Organism
yli  Yarrowia lipolytica
Pathway
yli04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:yli00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YALI0F18480g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Pex14_N
Motif
Other DBs
NCBI-GeneID: 2907870
NCBI-ProteinID: XP_505580
UniProt: Q6C182
LinkDB All DBs
Position
F:complement(2468187..2469257)
Genome map
AA seq 356 aa AA seqDB search
MLGFKTQGFNGYAANYSPFFNDKIAVGTAANYGLVGNGKLFILGISPEGRMVCEGQFDTQ
DGIFDVAWSEQHENHVATACGDGSVKLFDIKAGAFPLVSFKEHTREVFSVNWNMANKALF
CTSSWDSTIKIWTPERTNSIMTLGQPAPAQGTNASAHIGRQTAPNQAAAQECIYSAKFSP
HTDSIIASAHSTGMVKVWDTRAPQPLQQQFSTQQTESGGPPEVLSLDWNKYRPTVIATGG
VDRSVQVYDIRMTQPAANQPVQPLSLILGHRLPVRGVSWSPHHADLLLSCSYDMTARVWR
DASTGGNYLARQRGGTEVKCMDRHTEFVIGGDWSLWGDPGWITTVGWDQMVYVWHA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttgggattcaaaacacagggattcaacggctacgcggccaactactcgccgtttttc
aacgacaagattgcggtcggaacggcggccaactacgggctggtcggaaacggaaaactc
ttcattctgggcatctctcccgagggccgcatggtctgcgaaggccagtttgacacccag
gacggcatttttgatgtcgcgtggtccgagcaacacgaaaaccacgtggcaaccgcctgc
ggagacggatcagtcaagctgttcgacatcaaggccggtgccttccctctggtatcgttc
aaggagcacacacgggaagtcttctctgtcaactggaacatggccaacaaggcgctcttc
tgcacatcttcatgggactctacaatcaaaatctggacgccggaacgtacaaactccatc
atgacccttggccagcctgctccggcccagggaacaaacgcttcagctcacattggccgt
cagacggcccccaaccaggcagcagcccaggagtgcatttattcggcgaaattctcgcct
cacacagactcgattattgcatccgcacactccacaggaatggtcaaggtgtgggacact
cgagcaccccagcctctccagcaacagttttccacgcagcaaaccgagtctggaggacca
ccagaggttctgtcgctggactggaacaagtacagacccacagtgattgccacaggtggc
gttgatcggtctgttcaggtctacgatatccgaatgactcaacctgcagccaaccaaccc
gttcagccattgagcttgattctgggccacagactacccgtcagaggagtttcgtggtca
ccgcatcatgccgacttgctgctgtcgtgttcttacgacatgactgctcgagtttggcgg
gacgctagcactggaggcaactatctggctcgacagcggggtggaacagaagtgaaatgc
atggacagacacacagagttcgttattggcggcgactggtcgttatggggcgatcctgga
tggatcaccaccgttggatgggaccagatggtttatgtttggcatgcgtaa

DBGET integrated database retrieval system