KEGG   Yersinia massiliensis: DA391_00185Help
Entry
DA391_00185       CDS       T05402                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yma  Yersinia massiliensis
Brite
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DA391_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: AVX36216
UniProt: A9U914
LinkDB All DBs
Position
44105..44728
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKLSVEELIQD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFKSVDDFKATFEQA
AATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEAVAGASGFPIIGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgatgctttagaaccccatttcgat
aagcagacgatggaaatccatcacaccaaacaccaccagacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggcaaaactgagtgttgaagaactgattcaagac
ttggataaagttcctgcagaaaagcgcacctttatgcgcaacaacgcgggtggccatgct
aaccacagcctgttctggaaaggtctgaaactgggtactaccctgacaggtgacctgaaa
gccgctatcgagcgtgacttcaaatctgttgatgatttcaaagcaacatttgaacaagca
gcagcaacccgtttcggctcaggctgggcgtggctggtactgaaagctgacggcaagctg
gcagtcgtttctacggctaaccaagatagcccattgatgggtgaggcagttgctggcgca
tctggcttcccaatcatcggtctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgtcgcccagactacatcaaagcattctggaacgtggttaactgggacgaagccgca
gcgcgtttcgctcaagctaaataa

DBGET integrated database retrieval system