KEGG   Yersinia massiliensis: DA391_00715Help
Entry
DA391_00715       CDS       T05402                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yma  Yersinia massiliensis
Pathway
yma00564  Glycerophospholipid metabolism
yma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DA391_00715
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DA391_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N Lycopene_cycl FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: AVX36312
LinkDB All DBs
Position
complement(173072..174586)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRDLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTTLPAS
KGLRFGPESVLKSELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKEVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDAPQAVTRDYTLDVADEDGKAPLLSVFGGKLTTYRK
LAEHALEKLSTYYPNVGPAWTKTGALPGGDIGGSRDNYTVQLRHRYNWLPEALARRYTRT
YGSHSELILADATSIESLGEHFGHGVYEAELRYLVEKEWVVELDDAIWRRTKLGMALDET
QKQRIAQWLAAEQSKKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgct
gacgctgcagggcgtgacctgtccgttctgctgctggaagcacaagatttggcctgtgcg
acgtcttccgccagttccaaactgattcatggtggcttgcgctacctagaacactacgag
ttccgcttggtgagcgaagcactggccgaacgtgaagtcctgctgaggctggcaccgcat
atcgcattcccaatgcgcttccgcttaccacatcaaccacacctgcgccccgcttggatg
attcgcgcgggcctgttcctgtacgatcatttgggcaaacgcacgacgttacccgccagt
aaagggttgcgtttcggccctgagtcagtgttgaaatccgaattagtgcgcggtttcgaa
tattctgactgctgggtagatgatgctcgcttagtggtgctgaacgcacaggaagtggtt
gaacgtggcggtgaagtccgtacccgcaccaaagtgacccgcgcatggcgtgagcaaggt
ttatggatggttgaagcggtcgatgtgaacacaggtaaaacctttacttggcgcgccaaa
ggcttagtcaatgccactggcccatgggttaagcagttcttcgacgatggcctgaaactc
aaatcgccttatggtatccgcttgattaaaggcagccatatcgtggttcctcgggtacat
aaccaaccacaagcttatattctgcaaaacgaagaccaccgcattgttttcgttattcct
tggttagatgagtattccatcatcggcaccaccgatgtggagtaccacggcgatccgaaa
gaggtgaagatcgacgatcaagagattgattacctgcttaaagtttataatgaccacttt
aagaagcagttgggccgcgacgatatcgtttggacttattccggtgtccgcccattgtgc
gacgatgaatcagatgcgccgcaagccgtgacccgcgactacacgttggatgtggccgat
gaagatggcaaagcaccgttactctctgtctttggcggcaaactgaccacttatcgcaag
ctggcagaacacgcgctggaaaaactgtcgacctattacccaaatgtcggcccagcatgg
accaaaaccggcgctttaccgggtggggatattggcggtagccgcgataactacaccgtg
cagttgcgccaccgttataactggttacctgaggcgttggctcgtcgctatacccgcact
tatggtagccacagcgaactgattttagcggatgccactagcatcgaaagcctaggtgaa
cactttggccatggcgtgtacgaagcagaattgcgctatttggtcgagaaagaatgggtt
gtcgagcttgatgatgctatctggcgtcgtaccaaattgggtatggctttagacgaaaca
caaaaacagcgaattgcgcagtggttagctgctgagcaaagtaaaaaacaacagacactc
tcgctggtttcctga

DBGET integrated database retrieval system