KEGG   Yersinia massiliensis: DA391_06790Help
Entry
DA391_06790       CDS       T05402                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yma  Yersinia massiliensis
Pathway
yma00250  Alanine, aspartate and glutamate metabolism
yma00410  beta-Alanine metabolism
yma00430  Taurine and hypotaurine metabolism
yma00650  Butanoate metabolism
yma01100  Metabolic pathways
yma01110  Biosynthesis of secondary metabolites
yma01120  Microbial metabolism in diverse environments
yma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DA391_06790
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DA391_06790
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DA391_06790
   00430 Taurine and hypotaurine metabolism
    DA391_06790
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DA391_06790
Enzymes [BR:yma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DA391_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AVX37381
UniProt: A0A2R4NMM6
LinkDB All DBs
Position
1476779..1478179
Genome map
AA seq 466 aa AA seqDB search
MDKNNVFTNYNENDDVYASIDLAKSMPKSTFPAKERNARNVFSAIRDELMLDGNSRQNLA
TFCQTWVDDEIRELMDLSIDKNMIDKDEYPQTAEIEARCVRMLANLWNSPTPETTLGCST
IGSSEAAMLGGLALKWQWRNKRTAKGLPTDKPNMICGPVQICWHKFARYFDVELREIPLE
GDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVCDALDKLQKDTGLDIPMHID
GASGGFLAPFCAPELEWDFRLPRVKSINTSGHKFGLAPLGAGWVVWREASDLPEDLIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYATAQYLAEEISNIGPF
EMLFDGDSSKGIPALAWKLKDNAALGGYNLYDLADKLRSRGWQVPAYSMPANREDLVIQR
ILVRHGVSYDLGSLLIDDIKRALDYFKNHPVTKPLTEEEASGFNHG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaataacgtatttactaactacaatgaaaacgatgatgtgtacgcttctatt
gatttagcaaaatcgatgcctaaatctacttttccagcgaaagaacgtaatgcgcgtaat
gtgtttagcgctattcgtgatgaactcatgttagacggtaattctcgtcaaaacttggcc
actttttgccaaacatgggtcgacgacgaaattcgtgaattaatggatttgtctatcgat
aagaacatgatcgataaagatgaatatccgcaaacagcagaaattgaagcacgatgcgtg
cgaatgctggctaatctgtggaactccccaacaccagaaacgaccttgggttgctccact
attggctcctctgaagccgcgatgttaggagggctagcattaaaatggcaatggcgaaat
aagcgtactgcaaaagggctaccgaccgataaaccgaatatgatttgtgggccagttcag
atttgttggcataaatttgcccgttactttgatgttgaattgcgtgaaattccgttagaa
ggtgaccgtttgatcatgagcccagaagaggtgctcaagcgtgttgatgaaaacaccatc
ggtgtggtgccgacactcggcgtcacctttacttgccagtacgagccggtaaaagcagtt
tgtgatgcacttgataagctacaaaaagataccggcttggatatccctatgcatattgac
ggcgcgagcggcggcttccttgcgccattctgtgcgccagaactggagtgggatttccgt
ttgccgagagtcaaatctatcaatacttccggccataaatttggtttagcgccactcggg
gctggctgggttgtatggcgtgaagcctctgatttacctgaagatctcattttcaacgtc
aattaccttggcggcaacatgccaacctttgcgctgaacttctcgcgtcccggtggtcag
atcattgcgcagtactacaatttcttacgtctgggccgtgaagggtacgcaaaaatccat
aatgcttgctatgccactgcccagtatttggctgaggaaattagtaatatcgggccattt
gaaatgctgtttgatggtgacagcagtaaagggatcccagcattggcatggaagctgaaa
gataatgcggcgttaggtggatataacctctatgacttggccgataagttacgctctcgc
ggttggcaggtcccagcctattccatgccggcgaaccgagaagatttggttatccagcgt
attctggtgcgtcatggggtgagctacgacctcggtagcttgttgattgatgatattaaa
agagcgctagactatttcaaaaaccacccagtcacgaaacctctgactgaagaagaagcg
agtggttttaaccacggataa

DBGET integrated database retrieval system