KEGG   Yersinia massiliensis: DA391_10740Help
Entry
DA391_10740       CDS       T05402                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yma  Yersinia massiliensis
Pathway
yma00240  Pyrimidine metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DA391_10740
Enzymes [BR:yma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DA391_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AVX38095
UniProt: A0A2G4TWS8
LinkDB All DBs
Position
2280041..2280628
Genome map
AA seq 195 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDSRFGVGTVSSRIGLSSQAL
LYNHRTSLLSIIATEHQTKPVHCILLDECQFLTKEQVQELCQVVDDLHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDEQGRAVHDGEQIVIGGNESYVS
VCRRHYKEAIKAACL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactctgcaatgaatgcaggaaagtctacggcgctgtta
cagtcttcttataactaccaagaacgaggtatgcgtaccttagtatttacggctgagata
gatagccgctttggtgttgggaccgtcagttcacgtatagggctatcttcacaagctttg
ctctataatcacagaacatcattattatctattattgctactgagcatcaaacaaaaccc
gttcactgtattttgcttgatgaatgccaattcctgaccaaagaacaagtccaagaattg
tgtcaagtggtggatgatttacacatccctgtcctgtgttatgggttacgtactgatttt
ctcggtgagctatttcctggcagtaaatatttgctctcgtgggcagacaaattggttgag
ttaaaaaccatttgtcactgtggtcgcaaagcgaacatggtgctgcgtttggatgaacag
ggcagagcggtgcatgacggtgagcaaattgttattggtggcaatgagagttatgtctca
gtttgccggcgtcattataaagaagccattaaagctgcttgtctctag

DBGET integrated database retrieval system