KEGG   Yersinia massiliensis: DA391_11380Help
Entry
DA391_11380       CDS       T05402                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
yma  Yersinia massiliensis
Pathway
yma00220  Arginine biosynthesis
yma00250  Alanine, aspartate and glutamate metabolism
yma00471  D-Glutamine and D-glutamate metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DA391_11380
   00220 Arginine biosynthesis
    DA391_11380
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DA391_11380
Enzymes [BR:yma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     DA391_11380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AVX38213
UniProt: A0A2R4NQ17
LinkDB All DBs
Position
2434589..2435524
Genome map
AA seq 311 aa AA seqDB search
MKPDLKVLQHCVNKAHKQYSTAAGGHNASYIPYLASVPSTLAGLAVVTVDGDIIVAGDAE
YRFAIESISKVCTLALALEDVGPQKVQEKVGADPTGLPFNSVMALELHKGKPLSPLVNAG
AMSTVSLIQANDRETRWHNILQIQQQLCGAPISLSEEVNQSEQTTNFHNRAIAWLLYSAG
AMYCDPMEACEVYTRQCSTLLNTIELATIGATFAAAGINPISKLRVLTANHIPHLLAEMT
MEGLYGSSGDWAYNVGLPGKSGVGGGILAVVPGVMAIAGFSPPLDAVGNSVRGQKMVAHV
AKSMGYNLYKV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagacttaaaagtactgcaacactgtgtcaataaagcacataagcaatattca
accgccgcaggcgggcacaacgccagttatattccctatctggccagtgtcccatcaaca
ttagccggtctggccgtagtgaccgttgacggtgatattattgtggccggagatgctgaa
taccgttttgccatcgaatcgatttctaaagtatgtacactcgcactggctttagaagat
gttggcccgcaaaaagtacaagaaaaagtgggagcagaccccactggtttaccatttaat
tctgttatggcgctcgaattgcacaaaggaaaaccgctatcgcctttagtaaacgctggc
gcaatgtctactgtgagcttaattcaagcgaatgatcgtgaaacccgctggcacaatatt
ctgcaaattcagcaacaattatgtggcgcaccgattagcttgtccgaggaagtcaaccaa
tcggagcaaacgacaaatttccacaaccgcgcgattgcatggttactttattctgcgggt
gcgatgtattgtgatccgatggaagcttgcgaagtctatacccgccaatgttcgacactg
ctcaataccatcgaattggcgacaattggtgcaacttttgcggctgctggcattaatccc
attagtaagttacgtgtcttaacggccaatcacattccccatcttttggccgagatgacg
atggaagggttatatggcagctctggtgactgggcatataatgtggggttaccggggaaa
agtggcgttggcggtgggatattggccgttgtacctggcgtaatggcgatcgctggattc
tccccaccgttagatgccgtaggtaatagtgtgcgcggccagaaaatggtggctcatgtc
gcaaagtcaatgggttataatttgtacaaggtgtga

DBGET integrated database retrieval system