KEGG   Yersinia massiliensis: DA391_11755Help
Entry
DA391_11755       CDS       T05402                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yma  Yersinia massiliensis
Pathway
yma00480  Glutathione metabolism
yma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DA391_11755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yma02000]
    DA391_11755
Enzymes [BR:yma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DA391_11755
Transporters [BR:yma02000]
 Other transporters
  Pores ion channels [TC:1]
   DA391_11755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AVX38282
UniProt: A0A2R4NQ93
LinkDB All DBs
Position
2519436..2520044
Genome map
AA seq 202 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLAAKITETGQDYLSINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPAGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPEE
YKVIARERLDKQFSYVDSVLADHDFLLGKKFSVADAYLFTVTRWANALNIKITQRSHLDT
YMARVAERPAVKAALAAEDIKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggggcctgctctttgtctccacatattgtcttacgtgag
gcggggttagacttcagtattgaaagcgtcgatctggcggctaaaatcactgagacgggc
caagactatttaagcatcaatccaaaaggacaagtccccgcactattgctagacgacggt
agtttactcaccgaaggcgttgcgattgtgcaatatctggcagataaagtgcctgaccgc
catctgattgcccctgcgggtacgctctcgcgttatcatgcaattgagtggttaaacttc
gtggcgactgaattgcataaaggctttagcccgttgtttaaccccaaaacgccggaagaa
tataaagtgattgcccgcgaacgattggataagcaattcagttatgttgattcagtgtta
gccgatcatgatttccttttgggcaagaaattcagtgtggccgatgcgtatttatttaca
gttacccgctgggctaatgcactgaatattaaaataacgcagcgtagccatttggataca
tatatggcgcgagttgcagaacgtccagcggtcaaagcggccttggcagcagaagatatc
aagaagtaa

DBGET integrated database retrieval system