KEGG   Yersinia massiliensis: DA391_14230Help
Entry
DA391_14230       CDS       T05402                                 

Gene name
fabF
Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
yma  Yersinia massiliensis
Pathway
yma00061  Fatty acid biosynthesis
yma00780  Biotin metabolism
yma01100  Metabolic pathways
yma01212  Fatty acid metabolism
Module
yma_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DA391_14230 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DA391_14230 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yma01004]
    DA391_14230 (fabF)
Enzymes [BR:yma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     DA391_14230 (fabF)
Lipid biosynthesis proteins [BR:yma01004]
 Fatty acid synthase
  Component type
   DA391_14230 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AVX38726
UniProt: A0A2R4NRK1
LinkDB All DBs
Position
3023286..3024560
Genome map
AA seq 424 aa AA seqDB search
MNTRRVVITGMGVVSPLGCGIETVWQRLLAGQSGIRVLPDEIVGDLPAKIGGQVPTIAAD
TEAGFDPDKAVAPKDQKKMDRFIEFAMAAADEAIAQAGWQADDEEKQDRTATVIGSGIGG
FPSIAHAVRTTDSRGPKRLSPFTVPSFLVNLAAGHVSIKHHFKGPIGAPVTACAAGVQAI
GDAVRLIRNNEADVALCGGAEAAIDKVSLAGFAAARALSTGSNDAPEKASRPFDSARDGF
VMGEGAGLLIIEALEHALARGAQPLAEIVGYGTSADAYHMTSGAEDGDGAYRAMKIALRQ
AGITPSQVQHLNAHATSTPVGDLGEINAIKHLFGEGDTLAVTSTKSATGHLLGAAGGLET
IFTVLALRDQIVPATLNLENPDPAAQGLNIVAGQALPHEMTYALSNGFGFGGVNASILLK
RWVD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcgccgtgtagtgattacaggaatgggtgtcgtttccccattaggttgtggt
atcgaaactgtttggcagcgcctgttagcaggacaatccggtattcgtgtgttgcctgat
gagattgtcggtgatttacccgccaaaattggcggacaagtccccactatcgcagcagac
actgaagcaggctttgatccagataaagcggttgcgccaaaagatcaaaagaaaatggat
cgttttattgaatttgcgatggccgcagcggatgaagccattgcccaggcgggctggcaa
gcggacgacgaagagaagcaagatcgaaccgccacagtcattggttccggaatcggtgga
ttcccttcgattgcccatgcagtgcgaacgacagatagccgtgggcctaaacgtttatcc
cctttcaccgtaccttcctttttagtgaatctggccgcaggccatgtttcgattaagcat
catttcaaaggccctattggcgcacctgtcaccgcctgcgccgcaggtgtgcaagcgatt
ggcgatgcagtccgattgattcgtaacaatgaggctgatgtggctttatgcggtggcgct
gaagccgccattgataaagtcagtctggctggctttgccgccgctcgcgccctgtcaaca
ggctcgaatgatgccccggaaaaagcctctcgtccattcgatagcgcacgcgatggcttt
gtgatgggtgaaggtgcgggtttactgattatcgaggcgttggagcatgctctggcgcgt
ggtgcacagccgttagcggaaattgttggctatggcaccagtgcggatgcctaccatatg
acatcgggtgctgaagacggtgacggcgcataccgtgcaatgaaaattgctttgcgccaa
gcaggcattacgccctcacaggttcaacatttgaatgcacatgcaacctctactccagtg
ggcgatcttggcgaaattaatgcgattaagcatttgtttggtgagggtgacacattagca
gtgacttccactaagtctgctacaggccatttactgggtgctgcaggcggtttggagact
atttttactgtgctggccttacgtgatcaaatcgtaccggcaaccttgaatctggaaaat
cctgaccctgcagcccaagggcttaatatcgtggcaggtcaggcgttgcctcatgagatg
acttatgccctttcgaatggttttggttttggtggtgtgaatgccagtatcttgctgaaa
cgttgggtagattaa

DBGET integrated database retrieval system