KEGG   Yersinia massiliensis: DA391_15600Help
Entry
DA391_15600       CDS       T05402                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
yma  Yersinia massiliensis
Pathway
yma00020  Citrate cycle (TCA cycle)
yma00190  Oxidative phosphorylation
yma00650  Butanoate metabolism
yma01100  Metabolic pathways
yma01110  Biosynthesis of secondary metabolites
yma01120  Microbial metabolism in diverse environments
yma01130  Biosynthesis of antibiotics
yma01200  Carbon metabolism
Module
yma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DA391_15600 (sdhB)
   00650 Butanoate metabolism
    DA391_15600 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DA391_15600 (sdhB)
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DA391_15600 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     DA391_15600 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AVX38973
UniProt: A0A0T9RIR3
LinkDB All DBs
Position
complement(3359861..3360577)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLEAEEGRDMMLLDALIQLKETDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETSARLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTQAIGHIKSMLLQRGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgagttctcaatttatcgctataacccggacgtcgataacgcgccgcacatg
caagattacacgctggaagcggaagaaggccgggatatgatgttgctggatgcacttatc
cagttgaaggaaacagatccaacgctatcgtttcgtcgctcctgtcgtgagggtgtttgc
ggttccgatggtctgaatatgaatggcaaaaacggcttggcatgtatcacgccaatctca
gcgttgcaaaaaggtaataagaagattgtgattcgcccattaccggggctaccggtggtg
cgggatttagtcgtcgacatggggcagttttatactcagtacgagaaaattaagccttat
ctcttaaatgatggcaaaaatccgccagcgcgtgagcatttacaatcgcctgaacaacgc
gaaaagctggatggtctgtacgagtgcatcttatgtgcttgttgttcaacctcttgcccg
tcattctggtggaatcccgataagtttgtcggtccggcagggctgctggctgcctatcgc
ttcttgatagatagccgtgataccgaaacatcagcacgattggatgatctggacgacgct
ttcagtgttttccgctgccatagcatcatgaattgtgtcagtgtttgtcctaaaggtctt
aacccaacccaagcgattggtcacattaagtctatgttgttacagcgtggcgcgtaa

DBGET integrated database retrieval system