KEGG   Yersinia massiliensis: DA391_15605Help
Entry
DA391_15605       CDS       T05402                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
yma  Yersinia massiliensis
Pathway
yma00020  Citrate cycle (TCA cycle)
yma00190  Oxidative phosphorylation
yma00650  Butanoate metabolism
yma01100  Metabolic pathways
yma01110  Biosynthesis of secondary metabolites
yma01120  Microbial metabolism in diverse environments
yma01130  Biosynthesis of antibiotics
yma01200  Carbon metabolism
Module
yma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DA391_15605
   00650 Butanoate metabolism
    DA391_15605
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DA391_15605
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DA391_15605
    1.3.5.4  fumarate reductase (quinol)
     DA391_15605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like FAD_binding_3 Thi4 FAD_oxidored Lycopene_cycl DAO
Motif
Other DBs
NCBI-ProteinID: AVX38974
UniProt: A0A2R4NS85
LinkDB All DBs
Position
complement(3360632..3362398)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQMGLSCALISKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGLPFSRLDDGSIYQRPFG
GQSLNFGGGQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAFVGC
TAICIETGEVVYFKASATILATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQ
ESLMEQGASRDASDSDIEASLDRMNRWNNTRSGEDPVEIRKALQACMQNNFSVFREGDAM
ANGLEELKVIRERLQNARLDDTSSEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAH
SRFDFPERDDANWLCHSLYLPDTESMTRREVNMQPKLRPAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccggtcagagagtttgatgctgttgttattggtgcaggtggtgcaggtatg
cgcgccgcgctgcaaatttcccaaatggggctgtcttgcgccctgatatctaaagttttc
ccgactcgttctcataccgtgtctgcacagggcggtattaccgttgccttgggtaatacc
cacgaagacaactgggaatggcacatgtatgacaccgtcaaaggttctgattatatcggt
gaccaagacgctatcgagtatatgtgtaaaaccggcccagaagcggttctggaactggaa
cacatggggttacctttctcccgtttagacgatggcagcatttatcagcgtccattcggt
ggacagtcgctgaactttggcggtgggcaagccgcacgtactgcggcggcggctgaccgt
acagggcatgcactgctgcacaccctttatcagcaaaacctgaaaaaccacaccaccatt
ttttctgaatggtatgccttggatttagtgaagaatcaggacggggctttcgttggctgt
accgctatctgcattgaaaccggtgaagtggtttatttcaaagctagtgcaacgatattg
gcaacaggcggagcggggcgcatttatcaatccaccaccaatgcgcacattaataccggt
gacggtgttggtatggcactgcgtgcgggtgtacccgtgcaggatatggaaatgtggcag
ttccacccgaccggtatcgccggtgcaggggtactggtcacagaaggctgccgtggcgaa
ggcggttatttgctgaataagcacggcgagcgctttatggaacgttatgccccgaacgcc
aaagatttggcgggtcgtgacgtagtggcacgttccattatgatcgaaatccgtgaaggc
cgtggttgtgatggtccttggggtccacatgccaaactgaagttggatcacttaggtaaa
gatgtgctggagtcccgtctgccgggtattctggagttatcacgtacctttgcccacgtc
gacccagtcaaagaacctattccagtgatcccaacgtgccattacatgatgggcgggatc
ccaaccaaagtgacgggtcaggcgatcaccgtaaatgaaaagggtgaagatgttgtaatc
cctggtctgttcgctgtcggtgaaattgcctgtgtttccgtccatggtgcaaaccgtttg
gggggcaactcattactggacctggtggtatttggtcgcgctgctggcatgcatctgcaa
gagtcattgatggagcagggtgccagccgcgatgctagcgattcagatattgaagcttca
ctcgatcgcatgaatcgttggaataacacccgttcaggtgaagacccagttgagatccgt
aaagcactacaagcctgcatgcagaataacttctcggtcttccgtgaaggtgatgccatg
gcaaacggcttggaagaactgaaagttatccgtgaacgtctgcaaaatgcccgtctggat
gacacttccagtgagttcaatacccaacgtattgaatgtttggaattggataacctgatg
gaaaccgcgttttccaccgctgtgtcagcaaacttccgtaccgaaagccgtggcgcgcat
agtcgcttcgacttcccagaacgtgatgatgcgaactggctgtgccactcgctgtatttg
ccagacactgaaagcatgacccgccgtgaggtaaacatgcaacctaagctacgccccgcc
ttcccgccgaaagtgcgttcttattaa

DBGET integrated database retrieval system