KEGG   Yersinia massiliensis: DA391_18285Help
Entry
DA391_18285       CDS       T05402                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yma  Yersinia massiliensis
Brite
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DA391_18285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AVX39442
UniProt: A0A2R4NTJ2
LinkDB All DBs
Position
complement(3921191..3921715)
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAILFSSSLFAAEVTVTMNEALPEGNGKALGTVTVTETAYGLLFTPNLTGLT
TGIHGFHLHENPSCAAGQKEGKSVPALAAGGHFDPQKTGVHLGPYSDKGHLGDLPGLVVN
ADGTANYPVLAPRLKSLTELKQHALMIHAGGDNYADHPMALGGGGARMVCGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaatacttactgttaccggcaatattgttctccagcagcttgtttgccgcg
gaagtgactgtcaccatgaatgaagctttgccagaaggtaatggcaaagcgctgggcacg
gttacggtaactgaaacggcttatggcttattgtttacccctaatctgacagggctgacc
accggtattcatggtttccatttgcatgaaaacccaagttgcgcagcaggccagaaagag
ggcaaatccgtgccagcgctagcggctggcggtcattttgacccgcaaaaaacgggcgta
catcttggcccttactcagataaagggcatttgggtgacctaccgggactggtcgtcaat
gccgatggtactgccaactatccagtactggctccgcgcctaaagtcgttaactgagctg
aaacagcatgcgttgatgattcatgcgggtggcgataactatgctgaccatccaatggca
cttggcggcggcggtgcacggatggtctgtggcgtcatcgagtaa

DBGET integrated database retrieval system