KEGG   Yersinia massiliensis: DA391_21505Help
Entry
DA391_21505       CDS       T05402                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yma  Yersinia massiliensis
Pathway
yma00071  Fatty acid degradation
yma00280  Valine, leucine and isoleucine degradation
yma00281  Geraniol degradation
yma00310  Lysine degradation
yma00362  Benzoate degradation
yma00380  Tryptophan metabolism
yma00410  beta-Alanine metabolism
yma00640  Propanoate metabolism
yma00650  Butanoate metabolism
yma00903  Limonene and pinene degradation
yma00930  Caprolactam degradation
yma01100  Metabolic pathways
yma01110  Biosynthesis of secondary metabolites
yma01120  Microbial metabolism in diverse environments
yma01130  Biosynthesis of antibiotics
yma01200  Carbon metabolism
yma01212  Fatty acid metabolism
Module
yma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DA391_21505 (fadB)
   00650 Butanoate metabolism
    DA391_21505 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DA391_21505 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DA391_21505 (fadB)
   00310 Lysine degradation
    DA391_21505 (fadB)
   00380 Tryptophan metabolism
    DA391_21505 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DA391_21505 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DA391_21505 (fadB)
   00281 Geraniol degradation
    DA391_21505 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DA391_21505 (fadB)
   00930 Caprolactam degradation
    DA391_21505 (fadB)
Enzymes [BR:yma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     DA391_21505 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DA391_21505 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     DA391_21505 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     DA391_21505 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AVX39987
UniProt: A0A2R4NV35
LinkDB All DBs
Position
4617925..4620114
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALAVLEKQSELKGLMLRSA
KAAFIVGADITEFLSLFNAPPEKLHQWLVFANDIFNRLEDLPVPTISAINGYALGGGCEC
VLATDFRVASPETRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDALK
VGLVDAVVAPEKLTEAALAILKQAIDGKLDWQAARRPKLEPLKLNATEAAMCFTIAKGMV
MQVAGKHYPAPLTAVKTIEAAAKLGRSEALKLETNSFVPLAGSNEARALVGIFLNDQYVK
GKAKKLSKDISAPKQAAVLGAGIMGGGIAYQSALKCVPVVMKDINDKSLTIGMNEAAKLL
NKQLERGKIDGLKMANILATIQPTLDYTGIERAQIIVEAVVENPKIKAAVLAETESLISE
DAVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTIAAVVAF
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGSDFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAVGFPDRMKKDYRDAIDAMFDSQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDHLLAPISQPTQKFSDDEIIARTMIPMINEVVRCLEEGIIASPAEGDIALVY
GLGFPPFHGGIFRYLDTIGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTSQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcattggctagaaaatggtattgccgagttg
gtgtttgatgcaccaggttcagttaacaaactggataccaaaacggtagccaatttgggt
gaagccctagctgtattagaaaaacaaagtgaactcaaagggttgatgcttcgttctgct
aaagcagcctttattgtcggtgctgatatcaccgaatttctgtctctgtttaatgcccca
ccagaaaaactgcaccagtggctagttttcgctaacgatatattcaatcgcttagaagat
ttacccgtaccaaccatttccgcaattaatggttatgcattaggggggggatgtgaatgt
gttcttgccactgatttccgcgttgcttcaccggagacccgtattggtttaccagaaacg
aagctaggtatcatgccgggctttggtggttctgttcgtctgccacgcctattaggtgct
gatagtgcactggaaattattgctgcaggcaaagatattattgccaaagatgcactaaaa
gtcgggctggttgatgctgttgtcgctcccgaaaaactaacagaagctgcgttggccata
ctgaaacaagctattgacggcaagctcgactggcaagctgctcgtcgtccaaaactagaa
ccgttgaagttaaacgcaacggaagcagcgatgtgcttcaccattgctaaaggcatggtc
atgcaagtggcgggcaaacactatccagcaccactcactgcggtaaaaacaattgaagcc
gcggccaaattgggccgtagcgaagcactgaaattagaaaccaatagttttgtgccgttg
gcaggttccaatgaagcccgagccttggttggcatattcctgaacgaccaatatgttaaa
ggtaaagcgaaaaagctatctaaagatatcagtgcgccaaaacaggctgctgtattgggt
gctggaatcatgggcggcgggatcgcctatcaatcggcattgaaatgtgtgccggttgtt
atgaaagatattaatgataagtctttgacaatcgggatgaatgaagctgccaagttattg
aataagcagttggaacgcggcaaaattgatggtctgaaaatggccaatatcctagcgact
atacaacctactctagattataccggtattgaacgcgcccaaatcatcgttgaagcggtg
gtggaaaatccaaagattaaagctgctgtgctagcagaaacagaatcactgatcagtgaa
gatgctgtattagcgtctaatacctctacgattccgatcgaccaactagccaagtcactt
aagcgtcctgaaaacttctgcggtatgcacttcttcaaccccgttcatcggatgccttta
gtagagattattcgtggtgctaaaacctctgataagacaattgcggcagtcgtggcattc
gctacacaaatgggcaaaacacccattgtagtaaatgattgccctggcttcttcgttaac
cgcgtcttattcccgtatctggctggatttggcatgttggtcagagatggtagtgatttc
cgtcagattgataaagtcatggaaaaacagtttggctggccaatgggacctgcttatctc
cttgatgtggttggtattgataccgctcaccatgcacaagcagtgatggctgttggtttc
cctgaccggatgaaaaaagattatcgcgatgcgattgacgccatgttcgatagccaacgg
tttggtcagaagaatggccaaggtttttaccgatatactcaggatgcgaagggaaaacca
cgtaaagagaatgacgagcaagtcgatcacttattggccccaatcagccaaccgacccaa
aaattcagcgatgatgaaattattgcccgtacgatgattcctatgatcaacgaagtagta
cgttgtctggaagagggaatcattgctagccctgctgaaggggatatcgcgttagtctac
ggccttggcttccctccattccacggaggtatcttccggtatctcgacaccatcggtagc
gccaattatgttgaaatggctcaacgttacgcccaccttggtgcgttgtatcacgttcca
gcagggcttagagccaaagctgaacataacgagagctattatcctgtggcagcagcgctg
cttgatgtttctaccagtcaaccggcatga

DBGET integrated database retrieval system