KEGG   Yersinia mollaretii: HRD69_16135
Entry
HRD69_16135       CDS       T06716                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ymo  Yersinia mollaretii
Pathway
ymo00480  Glutathione metabolism
ymo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ymo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HRD69_16135 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ymo02000]
    HRD69_16135 (gstA)
Enzymes [BR:ymo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HRD69_16135 (gstA)
Transporters [BR:ymo02000]
 Other transporters
  Pores ion channels [TC:1]
   HRD69_16135 (gstA)
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 Glyco_transf_8C GST_C_6 Tom37 Jiv90
Other DBs
NCBI-ProteinID: QKJ04389
LinkDB
Position
3619667..3620275
AA seq 202 aa
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLAAKITETGQDYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPAGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPEE
YKVIARERLDKQFSYVDSVLAHHDYLLGKKFSVADAYLFTVTRWANALNIEIKQRSHLDK
YMARVAERPAVKAALAAEDIKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccgcatattgtattacgcgaa
gcgggattagatttcagtattgaaagcgtcgatttggcggccaaaatcactgagacgggt
caagactatttaagcatcaacccaaaaggacaagtccccgcgctggtgctggatgacggt
agcctgctgaccgaaggggttgctatcgtgcaatatctggcggataaagtgcctgatcgc
catctaattgcccctgctggcaccctctcccgctatcatgccattgagtggttaaatttc
gttgcgactgaactgcataaaggcttcagtcccttgtttaacccgaaaacaccggaagag
tataaagtgatcgcccgcgagcggctggataaacaattcagttacgtggacagcgtgtta
gcgcatcatgattatctgctaggcaaaaaattcagtgtggccgatgcctatttgtttacc
gtgacccgctgggccaatgcactgaatattgagatcaaacagcgtagccatttggataaa
tatatggctcgcgttgctgagcgcccagccgtaaaagcggcgctggccgcagaagatatc
aagaaataa

DBGET integrated database retrieval system