KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0723Help
Entry
YPA_0723          CDS       T00369                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00061  Fatty acid biosynthesis
ypa01100  Metabolic pathways
ypa01212  Fatty acid metabolism
Module
ypa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPA_0723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypa01004]
    YPA_0723
Enzymes [BR:ypa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPA_0723
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     YPA_0723
Lipid biosynthesis proteins [BR:ypa01004]
 Fatty acid synthase
  Component type
   YPA_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABG12691
UniProt: Q1CA31
LinkDB All DBs
Structure
PDB: 

Position
complement(835207..835833)
Genome map
AA seq 208 aa AA seqDB search
MAITLAKLVQPGLIGLAQRTAVRYSAHFTNIRLTENMVDKRESYTKEDLEASGRGELFGA
GGPPLPAGNMLMMDRIVKMIEDGGSHNKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGL
DAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPDAKKVTYRINFKRVIMRKLIMGVA
DGEVLVDGKVIYTATDLKVGLFKDTNAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccattacgctggctaaactggttcaaccagggctaatcggacttgctcagcgtaca
gctgtacgctattctgcgcacttcactaacataaggcttactgagaacatggtagataaa
cgcgaatcctatacaaaagaagaccttgaagcatccggccgtggcgagttgtttggcgct
ggtgggccacccttacccgcaggcaatatgttaatgatggaccgtattgtcaaaatgata
gaagacggtggcagccataataaaggttatgtggaagcggaactggatatcaatccagat
ctatggttcttcggttgccattttatcggtgatcccgtcatgcctggctgtctgggcctt
gatgccatgtggcagttggttggtttctatctcggctggctcggtggcgaaggcaaaggc
cgcgcactgggtgttggtgaagttaaattcaccggccaggtgctgccagatgcgaaaaaa
gtgacataccgtattaattttaaacgcgtgattatgcgtaaattaattatgggcgttgcg
gatggtgaagtcttggttgatggcaaagtgatttacactgccactgatttgaaagtaggt
ctgtttaaagacaccaacgctttctaa

DBGET integrated database retrieval system