KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0747Help
Entry
YPA_0747          CDS       T00369                                 

Definition
(GenBank) putative (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00061  Fatty acid biosynthesis
ypa00780  Biotin metabolism
ypa01100  Metabolic pathways
ypa01212  Fatty acid metabolism
Module
ypa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPA_0747
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YPA_0747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypa01004]
    YPA_0747
Enzymes [BR:ypa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPA_0747
Lipid biosynthesis proteins [BR:ypa01004]
 Fatty acid synthase
  Component type
   YPA_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA NKWYS
Motif
Other DBs
NCBI-ProteinID: ABG12715
UniProt: A0A0E1NNE2
LinkDB All DBs
Position
859503..860027
Genome map
AA seq 174 aa AA seqDB search
MKNTELNFLKTNFLFNQDITNELNTSFGQDIIKKMIPHREPFLMVDNVELINIECRLIKA
IRRVDEKDPVFGGHFPNDPIYPGVLQQESMFQTALILMYFLLNETAIPPAEENIIHAVGT
RVYDVFHLSAVRPGELMTIRCCITEYDTFLATAIVQITVNDQIVTVGKGEFHVF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactgaattaaattttttaaaaacgaattttttatttaaccaagatattact
aatgaattgaatacatcatttggacaagatatcattaaaaaaatgataccgcatcgtgaa
ccatttttaatggtcgacaacgtagagctgatcaatattgaatgcaggttaataaaagca
ataagaagagttgacgaaaaagacccggtatttggtggtcatttccccaatgaccctata
tatccaggtgtattgcaacaagaaagtatgtttcaaaccgcgcttattttaatgtatttt
ctgctaaatgaaacggctattccgccagcagaggagaatatcatccacgcagtgggaaca
cgagtatacgatgtctttcacttgtccgcagtacgcccaggagaattaatgacaatccgt
tgttgtattacagaatacgacacatttcttgccaccgccattgttcaaatcacggttaac
gatcagatcgtaaccgtcggaaaaggagagtttcatgtcttctga

DBGET integrated database retrieval system