KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0939Help
Entry
YPA_0939          CDS       T00369                                 

Definition
(GenBank) putative penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ypa01002]
    YPA_0939
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypa01011]
    YPA_0939
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPA_0939
   3.4.21  Serine endopeptidases
    3.4.21.-  
     YPA_0939
Peptidases [BR:ypa01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   YPA_0939
Peptidoglycan biosynthesis and degradation proteins [BR:ypa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YPA_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ABG12907
UniProt: A0A0E1NW93
LinkDB All DBs
Structure
PDB: 

Position
complement(1087432..1088598)
Genome map
AA seq 388 aa AA seqDB search
MDKRLLKRLSAPLLAAALWTIPLHSHADTQPLTSQDTKLLTSQIVDQYAEHIFYNSGAVG
MALVVIDNNQVVNRSFGETQPGNNIRPRPDSLIRIASITKLMTSEIMVKLADDGIVKLTD
PLKKYAPKGVNVPSYSAKQPIRLLHLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLK
LAKVTVPPGVKAAYSNLAYDLLADALSRAAGKPYAHLLRDKITAPLGMKNTTLTPTAEQC
KRLMIGVGSSRCGNTVAAAGSGGIYSTPEDMQHWMQQFLASDNSAPKRSAKREQALYFQR
GDLVSLKGMDVAGQADALGLGWVYMAPKADLPGIMQKTGGGGGFITYMAMVPEKNIGVFV
VVTRSQLTKFSNMSDGVNQLVAELVKNH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagattgttgaaacgtctctctgccccgctgctggctgctgctttgtggact
attccgttgcacagccatgccgatactcagccgttgacctcgcaagatactaagctgttg
acctcgcaaattgttgaccaatacgccgaacatatcttctataacagtggagctgtagga
atggctctggtggttatcgataacaatcaggtcgtcaaccgtagctttggtgaaacgcaa
cccggcaacaatattcgcccacggccagactcactgatccgcattgcatcaataaccaag
ctaatgaccagcgaaatcatggtaaaactggctgatgatggcatcgttaagttaactgac
ccgttaaaaaaatatgcaccgaaaggggtcaacgttccctcttacagtgctaagcaacct
attaggctgttgcatctggccagccataccagcggcctcccccgtgagcaacccggcggc
ccgcaaaaaagaccggtgtttacctggccgaccaaagataatcgctggcaatggttgaaa
ctggccaaagtgaccgttccaccaggcgtgaaagccgcttactctaatttagcttacgac
ttactggctgacgcactgtcacgagctgcggggaaaccgtatgcccacttattacgtgat
aaaatcaccgcaccactggggatgaaaaataccaccctgaccccgacggcggagcaatgt
aaacgcctgatgataggtgttggcagcagtcgttgtgggaatacagttgcagcagcaggt
agtggcggcatttactcgacccccgaagatatgcagcactggatgcaacaattcttagct
tctgataacagcgcccccaagcgttccgccaaacgtgagcaagcgctttacttccagcgc
ggtgacttggtgtcattgaaaggtatggatgtcgccggtcaagctgatgctctgggctta
ggctgggtttatatggcacctaaagctgacttaccgggcattatgcaaaaaaccggcggt
ggcggtggatttattacttatatggcgatggtcccagaaaaaaacattggcgtttttgtg
gtggtcacacgaagccaactgactaaattcagcaatatgagtgatggtgtgaatcaattg
gttgctgagttggtgaaaaatcattga

DBGET integrated database retrieval system