KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1222Help
Entry
YPA_1222          CDS       T00369                                 

Definition
(GenBank) putative cystine-binding periplasmic protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YPA_1222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypa02000]
    YPA_1222
   02035 Bacterial motility proteins [BR:ypa02035]
    YPA_1222
Transporters [BR:ypa02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    YPA_1222
Bacterial motility proteins [BR:ypa02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    YPA_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 PetG
Motif
Other DBs
NCBI-ProteinID: ABG13189
UniProt: A0A0E1NTS5
LinkDB All DBs
Position
1372094..1372894
Genome map
AA seq 266 aa AA seqDB search
MSFSIVRRRIVLGMVAVALATGLNVKSYAAGDLLEQVKQRGTLIVGLEGTYPPFSFQGED
GKLTGFEVDFANALAEHMGVKAKITPTKWDGMLASLESKRIDVAINQVTISDERKKKYDF
STPYTVSGIQVLTKKGNEGQFTKPEDLQGKKVGVGLGSNYEQWLRENLKDVDIRTYDDDP
TKYQDLRVGRTDAILVDRLAALDLVKKTNDALAVAGPAFARQESGVAMRKNNPELLAAVN
NAIAEMQKDGTLAKISEKYFGADVTQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttcaattgtacgtcgccgcattgttctgggcatggtggcggtcgcactggca
accggcttgaacgtgaagtcttacgctgctggtgacctgttggagcaggttaaacaacgc
ggcaccctgattgttgggttagaggggacttatccgccgttcagttttcagggcgaggat
ggcaaactcactggttttgaagtggattttgccaacgcattggctgaacacatgggggtc
aaagctaaaatcacgccaaccaaatgggatgggatgctggcctcgctggagtctaaacgt
attgatgtggccattaaccaggtcactatctcagatgaacgtaagaaaaaatatgacttc
tcaacaccttataccgtttctggtattcaagtactgaccaaaaaaggtaacgaaggccag
tttactaagccagaagatttacagggtaagaaggttggcgtgggtttaggcagtaactat
gagcagtggttacgtgaaaacctgaaagacgttgatattcgcacctatgatgatgaccca
acgaaatatcaggatctgcgtgttggccgtaccgacgccattttggttgaccgcttagcg
gcattggatttggtgaagaaaactaacgatgcactggcggtggctggccccgcgtttgca
cgccaagaatcgggtgtggcgatgcgcaaaaataaccctgaattgttagccgcagtcaat
aatgctattgctgagatgcaaaaagacggcacgctagccaagatctctgagaaatacttt
ggtgcggacgtgactcaataa

DBGET integrated database retrieval system