KEGG   Yangia pacifica: CEW88_02865Help
Entry
CEW88_02865       CDS       T05431                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ypac  Yangia pacifica
Pathway
ypac00240  Pyrimidine metabolism
ypac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CEW88_02865
Enzymes [BR:ypac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CEW88_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AWI82700
UniProt: A0A2U8HAU3
LinkDB All DBs
Position
1:complement(585329..585916)
Genome map
AA seq 195 aa AA seqDB search
MAKLHFHYSTMNAGKSTLLLQAAHNYRERGMEVFLLTARLDTRAGHGRIGSRIGLGQDAE
TFGGEDDLFAVIAAAHGKTPLACVFIDEAQFLTDKQVWQLARVVDDLGLPVMAYGLRVDF
RGQLFPGSAALLALADSLREVRTICHCGRKATMVIRQDETGKALSDGAQVQIGGNETYVS
LCRKHWRAAMGDTPA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcttcatttccactactccaccatgaacgccggcaaatcgaccctgctgctg
caggcggcgcacaactaccgcgaacggggcatggaggtcttcctcctgaccgcgcggctc
gacacgcgcgccgggcatggccgcatcggctcgcgcatcggtctgggacaggatgccgag
accttcggcggcgaggacgatctcttcgcggtgatcgccgcagcgcacggcaagaccccg
ctcgcctgcgtgttcatcgacgaggcgcagttcctcaccgacaagcaggtctggcagctg
gcgcgggtggtggacgatcttgggctgccggtcatggcctatgggctgcgggtggatttc
cgcggtcagctctttcccggctcggcggcgttgctggcgctcgcagattcgctgcgcgag
gtgcgcaccatctgccattgcgggcggaaggcgaccatggtgatccggcaggacgagacc
ggcaaggcgctcagcgatggtgcgcaggtgcagatcggcggcaacgagacctatgtctcg
ctctgccgcaagcactggcgcgcggcgatgggcgacacccccgcctga

DBGET integrated database retrieval system