KEGG   Yangia pacifica: CEW88_11125Help
Entry
CEW88_11125       CDS       T05431                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ypac  Yangia pacifica
Pathway
ypac00020  Citrate cycle (TCA cycle)
ypac00190  Oxidative phosphorylation
ypac00650  Butanoate metabolism
ypac01100  Metabolic pathways
ypac01110  Biosynthesis of secondary metabolites
ypac01120  Microbial metabolism in diverse environments
ypac01130  Biosynthesis of antibiotics
ypac01200  Carbon metabolism
Module
ypac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypac_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEW88_11125
   00650 Butanoate metabolism
    CEW88_11125
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEW88_11125
Enzymes [BR:ypac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CEW88_11125
    1.3.5.4  fumarate reductase (quinol)
     CEW88_11125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_16 Fer4_9 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AWI84185
UniProt: A0A2U8HHF8
LinkDB All DBs
Position
1:complement(2315458..2316237)
Genome map
AA seq 259 aa AA seqDB search
MVQFTLPKNSKIRTGKTWPKPEGATNVRAFKIYRWNPDDGENPRVDTYFLDMDKCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEVKGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPQKEWRQSIEDRKKLDGLYECVMCASCSTAC
PSYWWNSDRYLGPAALLHAYRWIIDSRDEATGERLDQLEDPFKLYRCHTIMNCAKTCPKG
LNPAKAISEIKKMMLNRHV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattcacacttcccaagaactccaagatccgcaccggcaaaacctggccgaag
cccgagggcgcgaccaacgtgcgggcgttcaagatctaccgctggaaccccgatgacggc
gagaacccgcgggtcgacacgtatttcctcgacatggacaaatgcggtccgatggtcctg
gacgcgctgatcaagatcaagaacgagatcgatccgacgctgaccttccgccgctcctgc
cgcgaagggatctgcggctcctgcgcgatgaacatcgacgggatcaacaccctcgcctgc
atctacggcctcgatgaggtcaagggcgacgtgaagatctacccgctgccgcacatgccg
gtggtcaaggacctgatccccgatctgacgcatttctatgcccagcacgcctcgatcatg
ccctggctggaaaccaagaccaaccgtccccagaaggagtggcggcagtccatcgaggac
cgcaagaagctcgacggtctttatgagtgcgtcatgtgcgcctcgtgctcgaccgcctgc
ccgagctactggtggaactccgaccgctacctcggcccggcggcactgctgcacgcctac
cgctggatcatcgacagccgcgacgaagccaccggcgagcgcctcgatcagctcgaggac
ccgttcaagctctatcgctgccacacgatcatgaactgcgccaagacctgcccgaagggt
ctgaacccggcgaaagcgatctccgagatcaagaagatgatgctgaaccggcacgtctga

DBGET integrated database retrieval system