KEGG   Yangia pacifica: CEW88_11135Help
Entry
CEW88_11135       CDS       T05431                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ypac  Yangia pacifica
Pathway
ypac00020  Citrate cycle (TCA cycle)
ypac00190  Oxidative phosphorylation
ypac00650  Butanoate metabolism
ypac01100  Metabolic pathways
ypac01110  Biosynthesis of secondary metabolites
ypac01120  Microbial metabolism in diverse environments
ypac01130  Biosynthesis of antibiotics
ypac01200  Carbon metabolism
Module
ypac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypac_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEW88_11135
   00650 Butanoate metabolism
    CEW88_11135
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEW88_11135
Enzymes [BR:ypac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CEW88_11135
    1.3.5.4  fumarate reductase (quinol)
     CEW88_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO FAD_oxidored PEARLI-4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AWI84187
UniProt: A0A2U8HE92
LinkDB All DBs
Position
1:complement(2316555..2318357)
Genome map
AA seq 600 aa AA seqDB search
MAAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
ANMGPDNWQWHMYDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLLMEDGVC
KGVLCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME
FVQFHPTGIYGSGCLITEGARGEGGYLTNKDGERFMERYAPQYKDLAPRDYVSRCMTMEI
REGRGVGEHGDHIHLNLAHLPKEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMG
GIPTNYWGEVLNPTGENPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR
AGEVVDRSGAVPTAPKSQIDKAFDRFDGVRNASGAIPTAELRLEMQRTMQADAAVFRASE
TLKDGKEKMTEIAGKLGDIKVTDRSLIWNSDLMESLELTNLMPNAIATIVGAEARHESRG
AHAHEDFANRDDENWRVHTISRVEGNKVELSYRPVVVDPLTTEAEGGISLKKIAPKARTF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacgaatacgagacgcatgattatgacgtcgtggtcgtgggggccggcggc
gccggcctgcgcgccaccctcggcatggcagagcagggccttcgcaccgcctgcgtgacc
aaggtcttcccgacccgctcgcacaccgtcgcggcgcagggcggcatcgccgcctcgctg
gcgaacatgggcccggacaactggcagtggcacatgtacgacacggtgaagggctccgac
tggctcggcgacaccgacgcaatggaatacctcgcccggtccgcccccgccgcggtttac
gagctcgagcactacggcgtgcccttctcgcgcaccgaggaaggcaagatctaccagcgc
cccttcggcggccacaccaccgagttcggtgaaggccccgccgtgcagcgcacctgcgcc
gcggccgacagaaccggccacgccatcctgcacacgctctatggccagtcgctgaagaac
aacgccgagttctacatcgaatatttcgcgatcgacctgctgatggaagacggcgtctgc
aagggcgtgctgtgctggaagctcgacgacggcaccttccacgtcttcaacgccaagatg
gtcgtgctggccaccggcggttacggccgggcctacttctcggccacctcggcacacacc
tgcaccggtgacggcggcggtatggtggctcgtgcgggcctgccgctgcaggacatggaa
ttcgtgcagttccacccgaccggcatctacggctcgggctgcctgatcaccgagggcgcc
cgcggcgaaggcggctacctgaccaacaaggatggcgagcggttcatggagcgctacgcg
ccccagtacaaggacctcgcgccgcgcgattacgtctcgcgctgcatgaccatggaaatc
cgcgaaggccgcggcgtgggcgagcatggcgaccatatccacctgaaccttgcgcacctg
cccaaggaagcgctcgccgagcgtctgccgggcatctcggaaagcgcgaagatcttcgcc
ggcgtggacgtgacgaaagagccgatcccggttctgccaaccgtgcactacaacatgggc
ggcattcccacgaactactggggcgaggtgctgaacccgaccggcgagaatccgaacgct
gtcgtgccgggcctgatggccgtgggcgaggcgggctgcgcctcggtgcacggggcgaac
cgcctcggctccaactcgctgatcgacctcgtggtcttcggccgcgccgccgcgatccgc
gccggcgaagtggtggaccgttcgggcgccgtgccgaccgcgccgaaatcgcagatcgac
aaggccttcgaccggttcgacggcgtgcgcaacgcctcgggcgcgatcccgaccgccgag
ctgcgtctcgagatgcagcgcaccatgcaggcagatgccgccgtgttccgcgcctccgag
acgctgaaggacggcaaggaaaagatgaccgagatcgccggcaagctgggcgacatcaag
gtcaccgaccgctcgctgatttggaactcggacctgatggaaagcctcgagctgaccaac
ctcatgccgaacgcgatcgcgaccatcgtgggtgcagaagcgcggcacgagagccgcggc
gcccacgcgcacgaggacttcgccaaccgggacgacgagaactggcgcgtgcacaccatc
agccgcgtcgagggcaacaaggtcgaactcagctaccgcccggtggttgtcgacccgctg
accaccgaagccgagggcggcatctcgctgaagaagatcgcgccgaaggcacggacgttc
tga

DBGET integrated database retrieval system