KEGG   Yangia pacifica: CEW88_20280Help
Entry
CEW88_20280       CDS       T05431                                 

Definition
(GenBank) dehydrogenase
Organism
ypac  Yangia pacifica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NADH_4Fe-4S FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AWI86088
UniProt: A0A2U8HJZ2
LinkDB All DBs
Position
unnamed1:252340..253347
Genome map
AA seq 335 aa AA seqDB search
MKALVYEGPRTVAVRDVPRPKTKGVRLRLHYCGVCGTDIGIYAGSHPRAQAPLILGHEFI
GEVIEDHAGFTKGQRVTAFPLISCGACHPCRTGSPHVCANLRLLGIDCDGGMAEEITVAP
ELLVPVPDDVPDELAALIEPVAVCLRVADRAAVTMGDTCVVTGAGPIGLITALMLRHAGG
GRILISDIAPGRLRLAEELGFEPVNARAETLAAAVAAATDGDGADVLVECSGAAPAALEM
TRLVRTGGTICLASLFKAPTPVALLDMSFKELRLVGSRVYTREEFRRATALVAQLETPLA
KLITRIVPLSDAGDVFELATDPEAGMVKVLVDCRG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctggtctatgaagggccgcggacagtcgccgtgcgcgatgtccctcgcccc
aaaaccaaaggggtccgtctgcggctgcactactgcggcgtctgcgggacggacatcggc
atctacgcgggcagccacccgcgtgcgcaggcgccgctgatccttggtcacgagttcatc
ggcgaagtgatcgaggatcacgccggattcaccaagggccagcgggtcaccgctttcccc
ctgatctcctgcggcgcctgccatccctgccggaccggcagcccgcatgtctgcgccaac
ctgcgccttcttggcatcgactgtgacggcggcatggccgaggaaataaccgtcgcgccc
gagctgctggtcccggtacccgacgatgtcccggacgagctcgcggcgctgatcgagccg
gtcgccgtctgcctgcgggtggcggaccgcgccgcggtcaccatgggcgacacctgcgtc
gtcaccggcgcggggccgatcgggctcatcaccgcgttgatgctgcgccacgccggcggc
gggcgcatccttatctcggacatcgcgccgggacggctgcgacttgccgaggaactgggg
ttcgagcccgtgaatgcccgtgcggagacccttgccgcggcggtggccgcggccaccgac
ggcgacggcgcggacgtgctggtggaatgctccggcgcggcgcctgcggcgctcgagatg
acgcggctcgtgcgcaccggcggcacgatctgcctcgcttcgctgttcaaggccccgacc
ccggtcgcgctgctcgacatgagcttcaaggagctgaggctcgtcgggtcacgggtctac
acgcgtgaggaattccgccgcgccacggcgcttgttgcgcagctcgagacgccgctggcg
aaactgatcacccggatcgtgccgctcagcgacgcgggcgatgtcttcgagctggccacg
gatccagaggccggcatggtgaaggtgctggtcgactgccggggctga

DBGET integrated database retrieval system