KEGG   Yangia pacifica: CEW88_21510Help
Entry
CEW88_21510       CDS       T05431                                 

Definition
(GenBank) cobaltochelatase subunit CobN
  KO
K02230  cobaltochelatase CobN [EC:6.6.1.2]
Organism
ypac  Yangia pacifica
Pathway
ypac00860  Porphyrin and chlorophyll metabolism
ypac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEW88_21510
Enzymes [BR:ypac01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.2  cobaltochelatase
     CEW88_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel
Motif
Other DBs
NCBI-ProteinID: AWI86354
UniProt: A0A2U8HKK3
LinkDB All DBs
Position
unnamed2:24601..27927
Genome map
AA seq 1108 aa AA seqDB search
MHVVFRESHGLEDLETPTDLMQDPADLVVLSFSDSDLGAFAEAWHQSGGSLPSLRLANLA
QLRHPLSVDTYVERTLAGARGILVRLIGGLPYWDYGLLQLQALAQRQGIALAVLPADGRP
DPRLDEVSTLPLSTLRQLARLCDTGGPAAAQAALAQLALASGLGAPPVRGARALPEVGLW
TPETGPEPLDEPRSAAPRAPRRIWKEKTGRRILLVFYRAYLVAADIAPIAALFAAFRAEG
CEVVGLFAPSLKAPRAAAALQEAVARLCPDAIVSATAFSGRGAAGSPLDAAGVPVFQVAL
ATSTEEAWGAADRGLSPADLAMHVVLPEVDGRLLAGVVSFKAHGERDPELQFARTLHRPH
GPGIAAAVARVMGWLRLAAQPAAERRVALILSTYPGKDWNLGHAVGLDAPASARAILEDL
RAAGYAVPEAGADLETALQDRSLRLPLAEYRAALAQLPERLRQQITATWGAPEADAQIDG
DAFRVAALELGPCLIALQPERGTPAARAGEYHDLARVPRHAYVAFYLWLQRRADALVHIG
AHGTLEWLPGKAVALSETCWPQVLTGALPVLYPFIVNDPGEAGQAKRRIGALTLGHLPPP
LAASEIPDRLTHLESLLDEFSTADGLDPRRRDRLQADIRAEARARGVEADLGLGEAASTA
EAITRIDRFVCDIKESRFGAGLHVWGRPPPGCTEPEILASAQAERAALIAALDGRRIEAG
PSGSPWRGRRDVLPSGRNLYTTDPRAVPSRAAHAQGVKLAEELMRRHLQDHGDWPRGLVV
DLWGSATMRTAGEEFAMALHLLGVRPVWDEGSARVSGLEVLPIAELDRPRIDVTLRVSGL
FRDVFPTLSGLFATAVAALAARDEAPEWNPYAGTAPGARVYGPAPGSFGLGMGAALDSYD
QEARRTAGEAWLAASSWALDGALDGAGATRDAAGIRARVAQAEAFVHLQDLPETDLLLAA
DYAAHEAGFAAAQATTGGQAALYHLDSTDPARPRARALPEEIARVVQARAANPRWIAGMR
AHGFRGAAEMAATLEHMAAFAHLAGAVGGHLFDLYHAATLGDPETEAFLRGANPGAHTAM
LERFRALREAGLWDSRRNSVIAALEDGS
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcgtcttccgcgaaagccacgggctcgaggacctcgagaccccgacggacctg
atgcaggatccggcggatctcgtggtgctgtccttctccgacagcgacctcggggccttc
gcggaagcctggcaccagagcggcggaagcctgccctcgctgcggctcgccaacctcgcg
cagctgcgccatccgctgtcggtcgacacctacgtggagcgcacgcttgcgggcgcgagg
ggcatcctcgtgcggctgatcggcgggctgccctattgggactacgggctcttgcagctg
caggcgctggcgcagcggcaggggatcgcccttgccgtgctgcccgccgacggccgcccc
gatccgcggctcgacgaggtctcgaccctgccgctctcgaccctgcgccagcttgcccgg
ctctgcgacaccggcggccccgccgcggcgcaggcggcgctggcacaactggcgctagcc
tcgggcctcggcgcgcccccggtgcgcggcgcgcgcgccctgcccgaggtgggcctttgg
acccccgaaaccgggcccgaaccacttgatgagccgaggagcgccgcccctcgcgcgccc
cggcgcatttggaaagagaagacggggcgacggattctcctcgtcttctaccgcgcctac
ctggtggcggcggacattgcccccatcgcggcactcttcgcggccttccgggccgagggc
tgcgaggtggtcgggctcttcgccccctcgctgaaagcgccccgcgcggcggcggcgctg
caagaggccgtggccaggctctgccccgacgccatcgtcagcgccaccgccttcagcggg
cgcggcgcggcgggctcgccgctcgacgccgcgggcgtgccggtcttccaggtggcgctc
gcaacctccaccgaagaggcctggggcgcggcggaccgggggctttcccccgccgatctg
gccatgcacgtggtgctgcccgaggtcgacgggcggcttctggccggggttgtctcgttc
aaggcgcacggagagcgagacccggagctgcaattcgcccgcaccctgcaccgccctcac
ggaccggggatcgccgccgccgttgcccgggtcatgggctggctgcggctggcggcacag
ccggcggccgagcgccgggtggcgctgatcctttcgacctaccccggcaaggactggaac
ctcggccacgcggtcggcctcgacgccccggcctcggcgcgggccatcctcgaggatctg
cgcgcggcgggatacgcggtgcccgaggcgggcgccgatctcgagacggcgctgcaggac
cgcagcctgcggctgccgctggcggagtaccgcgcggcgctggcccagctgccggagcgc
cttcggcagcagatcaccgccacctggggcgcgcccgaggcggacgcgcagatcgacggc
gacgccttccgggtcgcggcgctggaacttggcccctgcctcatcgccctgcagcccgag
cgcggcaccccggcggcgcgcgcgggcgagtaccacgatctcgcgcgggtgccgcgccat
gcctatgtcgctttctacctctggctgcagcgccgcgccgacgcgctggtgcatatcggc
gcccatggcacgctggaatggctgcccggcaaggcggtcgccctctccgagacctgctgg
ccgcaggtgctgaccggcgcgctgccggtgctctatccgttcatcgtcaacgatccgggc
gaggcgggacaggccaagcggcgcatcggcgcgctcaccctcggccatctgccgccgccg
ctcgccgcgagcgagatccccgaccggctgacccacctggaaagcctgctcgacgagttc
tccaccgccgacgggctcgacccgcgccgccgcgaccgactgcaggccgacatccgcgcc
gaggcccgcgcccgcggcgtcgaggccgacctggggctcggcgaggccgcctccaccgcc
gaggcgatcacccgcatcgaccgcttcgtctgtgacatcaaggaaagccgctttggcgcc
gggttgcacgtctggggccgcccgccaccgggctgcaccgagccggagatccttgcctcg
gcgcaggccgaacgggccgcgctcatcgccgcgctcgatggtcggcggatcgaggcgggg
ccctcggggtcgccctggcgcgggcggcgcgacgtgctgccgagcgggcgcaacctctac
accaccgacccgcgcgcggtgccgagccgcgccgcccatgcgcagggggtgaagctggcc
gaagagctgatgcgccgccacctgcaggatcacggtgactggccgcgcgggctggtcgtc
gatctctgggggtcggccaccatgcgcaccgccggcgaggaattcgccatggcgctgcac
ctcttgggcgtgcggccggtctgggacgagggctcggcgcgggtcagcggcctcgaggtg
ctgccgatcgccgagctcgaccgcccgcgcatcgacgtcacgctgcgggtctccgggctg
ttccgcgatgtcttccccacgctctcggggctcttcgcgacggcggtcgccgcgctggcg
gcgcgcgacgaggcgccggagtggaacccctatgccgggaccgcgccgggcgcgcgggtc
tacggcccggcgccgggcagcttcgggctgggcatgggggcggcattggacagctacgat
caggaggcccgacgcaccgccggggaggcctggctcgccgcctcgtcctgggcgctggac
ggggcactggacggcgcgggcgcgacccgcgacgcggccgggattcgcgcccgcgtcgcg
caggccgaggccttcgtgcaccttcaggatctgcccgagaccgacctgctgcttgccgcc
gactacgccgcgcatgaggcgggctttgccgccgcacaggccacgaccggcgggcaggcc
gcgctctaccatctcgacagcaccgaccccgcgcgcccccgcgcccgcgccctgcccgaa
gagatcgcccgcgtggtgcaggcccgcgccgccaacccgcgctggatcgccggaatgcgc
gcccatggcttccgcggcgccgccgagatggccgcgacgctcgagcacatggccgccttc
gcgcatctggcaggggcggtcggcgggcatctgttcgacctctatcatgcggcgacgctc
ggcgatcccgaaaccgaggccttcctgcgcggcgccaaccccggcgcccatacggcgatg
ctcgaacgcttccgcgcactgcgcgaggccgggctctgggacagccgccggaactcggtg
atcgccgcgctggaggacgggtcgtga

DBGET integrated database retrieval system